SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR261W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR261W-A   Protein: S000007396
Sequence length 438
Comment YDR261W-A SGDID:S000007396, Chr IV from 981459-982775, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLHQNPHSLHGSAAASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQNQHSEVPQAKTKVRNNVLPPHTLTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTSRNYHRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
Download sequence
Identical sequences Q99303
YDR261W-A YGR161W-A YDR261W-A 4932.YDR261W-A YDR261W-A YDR261W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]