SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR285W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR285W
Domain Number 1 Region: 191-331
Classification Level Classification E-value
Superfamily Tropomyosin 1.63e-05
Family Tropomyosin 0.0094
Further Details:      
 
Weak hits

Sequence:  YDR285W
Domain Number - Region: 321-381
Classification Level Classification E-value
Superfamily PhoU-like 0.0222
Family PhoU-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Rab GTPase binding 2.13 12.71
GTPase binding 1.682 4.28
protein domain specific binding 1.465 3.63
PDZ domain binding 2.17 3.63
Cellular Component IC (bits) H-Score
actin filament 2.158 43.7
cell division site 2.218 14.01
basal lamina 1.529 11.41
synapse part 1.512 11.19
cell cortex 1.621 9.51
synaptic membrane 1.862 7.9
growth cone 2.004 7.14
chromosomal part 1.478 6.63
dendrite 1.547 5.58
postsynaptic density 1.817 5.58

Protein sequence

External link(s) Locus: YDR285W   Protein: S000002693
Sequence length 875
Comment ZIP1 SGDID:S000002693, Chr IV from 1032433-1035060, Verified ORF, "Transverse filament protein of the synaptonemal complex; required for normal levels of meiotic recombination and pairing between homologous chromosome during meiosis; potential Cdc28p substrate"
Sequence
MSNFFRDSSMGFKPRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPH
KTSTEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIENDTDEDFEI
TEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKAPLHTSINNSSTSSNDVL
LEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERI
ATLTSHKNNQETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKG
KEIEYLKRELDDCSGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDKAHHLLQFNKF
EERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTETMLKQQYEDIKENLEQKMSSS
KDEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYA
SLENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEA
KNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVKA
LVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQ
NRHLKNCLEKKETGVEESLSDVKTLKQQVIVLKSEKQDITAEKLELQDNLESLEEVTKNL
QQKVQSQKRELEQKIKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLFPNNSAA
IHSPMKKCPKVDHISKSRINSSKETSKFNDEFDLSSSSNDDLELTNPSPIQIKPVRGKIK
KGSNCMKPPISSRKKLLLVEDEDQSLKISKKRRRK
Download sequence
Identical sequences A6ZYN4 B3LG09 C7GQT6 C8Z5J7 N1P555 P31111 W7QZY8
YDR285W 4932.YDR285W YDR285W YDR285W SCRT_00244 YDR285W YDR285W tr|A6ZYN4|A6ZYN4_YEAS7 YDR285W YDR285W YDR285W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]