SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR285W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR285W
Domain Number 1 Region: 191-331
Classification Level Classification E-value
Superfamily Tropomyosin 1.63e-05
Family Tropomyosin 0.0094
Further Details:      
 
Weak hits

Sequence:  YDR285W
Domain Number - Region: 321-381
Classification Level Classification E-value
Superfamily PhoU-like 0.0222
Family PhoU-like 0.01
Further Details:      
 

Protein sequence

External link(s) Locus: YDR285W   Protein: S000002693
Sequence length 875
Comment ZIP1 SGDID:S000002693, Chr IV from 1032433-1035060, Verified ORF, "Transverse filament protein of the synaptonemal complex; required for normal levels of meiotic recombination and pairing between homologous chromosome during meiosis; potential Cdc28p substrate"
Sequence
MSNFFRDSSMGFKPRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPH
KTSTEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIENDTDEDFEI
TEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKAPLHTSINNSSTSSNDVL
LEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERI
ATLTSHKNNQETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKG
KEIEYLKRELDDCSGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDKAHHLLQFNKF
EERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTETMLKQQYEDIKENLEQKMSSS
KDEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYA
SLENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEA
KNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVKA
LVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQ
NRHLKNCLEKKETGVEESLSDVKTLKQQVIVLKSEKQDITAEKLELQDNLESLEEVTKNL
QQKVQSQKRELEQKIKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLFPNNSAA
IHSPMKKCPKVDHISKSRINSSKETSKFNDEFDLSSSSNDDLELTNPSPIQIKPVRGKIK
KGSNCMKPPISSRKKLLLVEDEDQSLKISKKRRRK
Download sequence
Identical sequences A6ZYN4 B3LG09 C7GQT6 C8Z5J7 P31111
YDR285W 4932.YDR285W YDR285W YDR285W SCRT_00244 YDR285W YDR285W tr|A6ZYN4|A6ZYN4_YEAS7 YDR285W YDR285W YDR285W

Jump to [ Top of page · Domain architecture · Domain assignment details ]