SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR316W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR316W-A
Domain Number - Region: 68-176
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0175
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0654
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR316W-A   Protein: S000007398
Sequence length 440
Comment YDR316W-A SGDID:S000007398, Chr IV from 1096062-1097384, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPETY
Download sequence
Identical sequences A6ZLP7 E7NP66 P0CX65 P0CX66 P0CX67 P0CX68 P0CX69
YER159C-A YGR027W-A YJR028W YOR142W-A YPR137C-A YDR316W-A YER159C-A YGR161C-C YMR051C tr|A6ZLP7|A6ZLP7_YEAS7 4932.YDR316W-A 4932.YER159C-A 4932.YGR161C-C 4932.YMR051C YDR316W-A YER159C-A YGR161C-C YMR051C YBR012W-A YDR098C-A YDR261C-C YDR316W-A YER159C-A YGR027W-A YGR161C-C YJR026W YLR157C-A YLR227W-A YML045W-A YMR051C YOL103W-A YPR158C-C YBR012W-A YER159C-A YDR316W-A YER159C-A YGR161C-C YMR051C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]