SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR324C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR324C
Domain Number 1 Region: 44-363
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.23e-40
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 329-660
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-15
Family WD40-repeat 0.0077
Further Details:      
 

Protein sequence

External link(s) Locus: YDR324C   Protein: S000002732
Sequence length 776
Comment UTP4 SGDID:S000002732, Chr IV from 1116761-1114431, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MSSSLLSVLKEKSRSLKIRNKPVKMTSQERMIVHRCRFVDFTPATITSLAFSHKSNINKL
TPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGS
TVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHD
TILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTL
VWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGV
DRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINS
LTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMGTDSSTEQNYKLVCKL
TLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKF
IDNSKIVICSCEDDVFIVDLESEEDEKPQEVELLEVTSTKSSIKVPYINRINHLEVDQNI
AVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNS
EAENEDSESVLTQWSKNNTDNLPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFD
VDFPINKRRKQKKRTHEGLTITDESNFMNDEEDDEDDDIDMEISENLNVLLNQGNKIKST
DVQRNEESSGHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAFIQPKLVF
Download sequence
Identical sequences A6ZYS7 B3LFX2 C7GWM3 C8Z5N7 Q06679
YDR324C 4932.YDR324C YDR324C YDR324C SCRT_00204 YDR324C YDR324C tr|A6ZYS7|A6ZYS7_YEAS7 YDR324C YDR324C YR299 YDR324C YDR324C

Jump to [ Top of page · Domain architecture · Domain assignment details ]