SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR324C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR324C
Domain Number 1 Region: 44-363
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.23e-40
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 329-660
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000586
Family WD40-repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
endosome 1.351 9.77
cytoplasmic vesicle part 1.417 9.77
endosome membrane 1.934 9.77
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67

Protein sequence

External link(s) Locus: YDR324C   Protein: S000002732
Sequence length 776
Comment UTP4 SGDID:S000002732, Chr IV from 1116761-1114431, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MSSSLLSVLKEKSRSLKIRNKPVKMTSQERMIVHRCRFVDFTPATITSLAFSHKSNINKL
TPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGS
TVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHD
TILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTL
VWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGV
DRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINS
LTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMGTDSSTEQNYKLVCKL
TLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKF
IDNSKIVICSCEDDVFIVDLESEEDEKPQEVELLEVTSTKSSIKVPYINRINHLEVDQNI
AVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNS
EAENEDSESVLTQWSKNNTDNLPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFD
VDFPINKRRKQKKRTHEGLTITDESNFMNDEEDDEDDDIDMEISENLNVLLNQGNKIKST
DVQRNEESSGHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAFIQPKLVF
Download sequence
Identical sequences A0A0L8VU77 A6ZYS7 B3LFX2 C7GWM3 C8Z5N7 N1P595 Q06679
4932.YDR324C YDR324C SCRT_00204 YDR324C YDR324C YDR324C YDR324C YDR324C YDR324C YDR324C YDR324C tr|A6ZYS7|A6ZYS7_YEAS7 YR299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]