SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR329C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR329C   Protein: S000002737
Sequence length 441
Comment PEX3 SGDID:S000002737, Chr IV from 1127591-1126266, reverse complement, Verified ORF, "Peroxisomal membrane protein (PMP) required required for the proper localization and stability of PMPs; interacts with Pex19p"
Sequence
MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRITEQHFIKEQI
KRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQLKDQKNQLTRAKSSESRESSP
LKSKAELWNELELKSLIKLVTVTYTVSSLILLTRLQLNILTRNEYLDSAIKLTMQQENCN
KLQNRFYNWVTSWWSDPEDKADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLS
YNEIITNQIEIEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS
GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLINESFHFIMNKV
GIKTIAKKKPGQEDQQQYQMAVFAMSMKDCCQEMLQTTAGSSHSGSVNEYLATLDSVQPL
DDLSASVYSNFGVSSSFSFKP
Download sequence
Identical sequences A6ZYT1 N1P5A0 P28795
YDR329C YDR329C 4932.YDR329C YDR329C YDR329C YDR329C tr|A6ZYT1|A6ZYT1_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]