SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR329C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR329C   Protein: S000002737
Sequence length 441
Comment PEX3 SGDID:S000002737, Chr IV from 1127591-1126266, reverse complement, Verified ORF, "Peroxisomal membrane protein (PMP) required required for the proper localization and stability of PMPs; interacts with Pex19p"
Sequence
MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRITEQHFIKEQI
KRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQLKDQKNQLTRAKSSESRESSP
LKSKAELWNELELKSLIKLVTVTYTVSSLILLTRLQLNILTRNEYLDSAIKLTMQQENCN
KLQNRFYNWVTSWWSDPEDKADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLS
YNEIITNQIEIEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS
GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLINESFHFIMNKV
GIKTIAKKKPGQEDQQQYQMAVFAMSMKDCCQEMLQTTAGSSHSGSVNEYLATLDSVQPL
DDLSASVYSNFGVSSSFSFKP
Download sequence
Identical sequences A6ZYT1 N1P5A0 P28795
YDR329C YDR329C YDR329C YDR329C tr|A6ZYT1|A6ZYT1_YEAS7 4932.YDR329C YDR329C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]