SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR343C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR343C
Domain Number 1 Region: 69-271,302-525
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-60
Family LacY-like proton/sugar symporter 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
clathrin-coated vesicle 1.876 13.55
vacuolar part 1.621 12.57
cell projection membrane 1.527 11.06
secretory granule 1.826 9.38
brush border 1.48 8.22
coated vesicle 1.74 8.01
cytoplasmic vesicle membrane 1.917 7.82
transport vesicle 2.067 7.67
sperm part 2.207 6.34
synapse part 1.512 6.26

Protein sequence

External link(s) Locus: YDR343C   Protein: S000002751
Sequence length 570
Comment HXT6 SGDID:S000002751, Chr IV from 1161315-1159603, reverse complement, Verified ORF, "High-affinity glucose transporter of the major facilitator superfamily, nearly identical to Hxt7p, expressed at high basal levels relative to other HXTs, repression of expression by high glucose requires SNF3"
Sequence
MSQDAAIAEQTPVEHLSAVDSASHSVLSTPSNKAERDEIKAYGEGEEHEPVVEIPKRPAS
AYVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVS
IFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLG
VGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLG
LCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGV
EAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSF
ETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQP
SSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIG
FFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASW
VPPSRRGANYDAEEMAHDDKPLYKRMFSTK
Download sequence
Identical sequences P39003
4932.YDR343C YDR343C YDR343C YDR343C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]