SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR353W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR353W
Domain Number 1 Region: 2-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.45e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
oxidoreductase complex 1.828 16.08
transferase complex 1.369 14.71
organelle envelope 1.405 13.99
cilium 1.675 11.89
ciliary part 1.819 11.89
plasma membrane protein complex 1.527 9.08
respiratory chain complex 2.067 7.91
cytosol 1.295 7.03
outer membrane 2.091 6.83
nuclear outer membrane-endoplasmic reticulum membrane network 1.527 5.38

Protein sequence

External link(s) Locus: YDR353W   Protein: S000002761
Sequence length 319
Comment TRR1 SGDID:S000002761, Chr IV from 1183293-1184252, Verified ORF, "Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress"
Sequence
MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPD
GLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATG
ASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKV
FMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLP
VSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITS
AGSGCMAALDAEKYLTSLE
Download sequence
Identical sequences A0A0L8VTR2 A6ZYV3 B3LFU8 B5VGN5 C8Z5R4 E7KM14 E7LT28 E7NG51 G2WB91 H0GEH6 N1P789 P29509
YDR353W YDR353W YDR353W YDR353W YDR353W YDR353W SCRT_00178 YDR353W YDR353W 4932.YDR353W tr|A6ZYV3|A6ZYV3_YEAS7 YDR353W YDR353W YDR353W Pf-sce:YDR353W YDR353W YDR353W YDR353W YDR353W YDR353W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]