SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR362C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR362C
Domain Number 1 Region: 174-209,292-511,552-584
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000382
Family WD40-repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YDR362C   Protein: S000002770
Sequence length 672
Comment TFC6 SGDID:S000002770, Chr IV from 1198690-1196672, reverse complement, Verified ORF, "One of six subunits of RNA polymerase III transcription initiation factor complex (TFIIIC); part of TFIIIC TauB domain that binds BoxB promoter sites of tRNA and other genes; cooperates with Tfc3p in DNA binding; human homolog is TFIIIC-110"
Sequence
MAVIPAKKRGRPRKSVVAEVPYDSLASPVSENSGSKRPRRNASKKAVANFAQLVHAGRDD
VINTTQVNNVDDTDDDDFVLNDEGDGEESDNVEIEFENELESTKNEVADLNSSGSGASVR
PSGRRNTVQKLRLKKNSTKNMKSSSPGSSLGQKGRPIRLLKDLSSARDKIERIYGLNKEK
LLLLAKVKEGFETSVFDFPFKNIQPDSPYFVCLDPPCKKESAYNKVIGDKNRTVYHEINK
TEFENMIKLRTKRLKLLIGEVDAEVSTGDKIEFPVLANGKRRGFIYNVGGLVTDIAWLNI
EENTDIGKDIQYLAVAVSQYMDEPLNEHLEMFDKEKHSSCIQIFKMNTSTLHCVKVQTIV
HSFGEVWDLKWHEGCHAPHLVGCLSFVSQEGTINFLEIIDNATDVHVFKMCEKPSLTLSL
ADSLITTFDFLSPTTVVCGFKNGFVAEFDLTDPEVPSFYDQVHDSYILSVSTAYSDFEDT
VVSTVAVDGYFYIFNPKDIATTKTTVSRFRGSNLVPVVYCPQIYSYIYSDGASSLRAVPS
RAAFAVHPLVSRETTITAIGVSRLHPMVLAGSADGSLIITNAARRLLHGIKNSSATQKSL
RLWKWDYSIKDDKYRIDSSYEVYPLTVNDVSKAKIDAHGINITCTKWNETSAGGKCYAFS
NSAGLLTLEYLS
Download sequence
Identical sequences A6ZYW0 N1P5C8 Q06339 W7PWB1
4932.YDR362C tr|A6ZYW0|A6ZYW0_YEAS7 YDR362C YDR362C YDR362C YDR362C YDR362C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]