SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR362C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR362C
Domain Number 1 Region: 174-209,292-511,552-584
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.82e-11
Family WD40-repeat 0.046
Further Details:      
 

Protein sequence

External link(s) Locus: YDR362C   Protein: S000002770
Sequence length 672
Comment TFC6 SGDID:S000002770, Chr IV from 1198690-1196672, reverse complement, Verified ORF, "One of six subunits of RNA polymerase III transcription initiation factor complex (TFIIIC); part of TFIIIC TauB domain that binds BoxB promoter sites of tRNA and other genes; cooperates with Tfc3p in DNA binding; human homolog is TFIIIC-110"
Sequence
MAVIPAKKRGRPRKSVVAEVPYDSLASPVSENSGSKRPRRNASKKAVANFAQLVHAGRDD
VINTTQVNNVDDTDDDDFVLNDEGDGEESDNVEIEFENELESTKNEVADLNSSGSGASVR
PSGRRNTVQKLRLKKNSTKNMKSSSPGSSLGQKGRPIRLLKDLSSARDKIERIYGLNKEK
LLLLAKVKEGFETSVFDFPFKNIQPDSPYFVCLDPPCKKESAYNKVIGDKNRTVYHEINK
TEFENMIKLRTKRLKLLIGEVDAEVSTGDKIEFPVLANGKRRGFIYNVGGLVTDIAWLNI
EENTDIGKDIQYLAVAVSQYMDEPLNEHLEMFDKEKHSSCIQIFKMNTSTLHCVKVQTIV
HSFGEVWDLKWHEGCHAPHLVGCLSFVSQEGTINFLEIIDNATDVHVFKMCEKPSLTLSL
ADSLITTFDFLSPTTVVCGFKNGFVAEFDLTDPEVPSFYDQVHDSYILSVSTAYSDFEDT
VVSTVAVDGYFYIFNPKDIATTKTTVSRFRGSNLVPVVYCPQIYSYIYSDGASSLRAVPS
RAAFAVHPLVSRETTITAIGVSRLHPMVLAGSADGSLIITNAARRLLHGIKNSSATQKSL
RLWKWDYSIKDDKYRIDSSYEVYPLTVNDVSKAKIDAHGINITCTKWNETSAGGKCYAFS
NSAGLLTLEYLS
Download sequence
Identical sequences A6ZYW0 Q06339
YDR362C YDR362C 4932.YDR362C YDR362C YDR362C YDR362C tr|A6ZYW0|A6ZYW0_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]