SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR365W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR365W-A
Domain Number - Region: 68-176
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0175
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0654
Family HBL-like 0.054
Further Details:      
 

Protein sequence

External link(s) Locus: YDR365W-A   Protein: S000007400
Sequence length 440
Comment YDR365W-A SGDID:S000007400, Chr IV from 1206990-1208312, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPGTY
Download sequence
Identical sequences D2XNA6 P0CX70 P0CX71 P0CX72 P0CX73
YDR365W-A YER137C-A YLR157C-A YPL257W-A 4932.YDR365W-A 4932.YER137C-A 4932.YLR157C-A 4932.YPL257W-A YDR365W-A YER137C-A YLR157C-A YPL257W-A YDR365W-A YER137C-A YLR157C-A YPL257W-A YAR010C YDR098C-A YDR316W-A YGR038C-A YGR161C-C

Jump to [ Top of page · Domain architecture · Domain assignment details ]