SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR371C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR371C-A   Protein: S000028822
Sequence length 34
Comment YDR371C-A SGDID:S000028822, Chr IV from 1219606-1219502, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completeley overlaps the uncharacterized gene CTS2/YDR371W; identified by expression profiling and mass spectrometry"
Sequence
MGSMILDITGNSMSAIVKVVSNIIRPLVLKNFII
Download sequence
Identical sequences C8Z5T3 P0C5M1
YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A 4932.YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]