SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR371C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR371C-A   Protein: S000028822
Sequence length 34
Comment YDR371C-A SGDID:S000028822, Chr IV from 1219606-1219502, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completeley overlaps the uncharacterized gene CTS2/YDR371W; identified by expression profiling and mass spectrometry"
Sequence
MGSMILDITGNSMSAIVKVVSNIIRPLVLKNFII
Download sequence
Identical sequences C8Z5T3 P0C5M1
YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A 4932.YDR371C-A YDR371C-A YDR371C-A YDR371C-A YDR371C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]