SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR382W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR382W
Domain Number - Region: 65-103
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 0.0889
Family Methenyltetrahydrofolate cyclohydrolase-like 0.015
Further Details:      
 

Protein sequence

External link(s) Locus: YDR382W   Protein: S000002790
Sequence length 110
Comment RPP2B SGDID:S000002790, Chr IV from 1239485-1239817, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm"
Sequence
MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKGSLEEIIAEGQ
KKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEESDDDMGFGLFD
Download sequence
Identical sequences A6ZYY3 B3LFR8 C7GMF2 C8Z5U7 E7KB91 E7LT43 E7NG69 E7Q2E9 E7QDC1 G2WBC2 H0GEJ4 N1P738 P02400 W7Q588 W7R4B3
YDR382W YDR382W YDR382W YDR382W YDR382W YDR382W YDR382W YDR382W YDR382W YDR382W YR83 YT706 YDR382W YDR382W YDR382W YDR382W 4932.YDR382W YDR382W SCRT_00148 YDR382W YDR382W tr|A6ZYY3|A6ZYY3_YEAS7 YDR382W YDR382W YDR382w___KOG3449 YDR382W YDR382W YDR382W YDR382W

Jump to [ Top of page · Domain architecture · Domain assignment details ]