SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR398W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR398W
Domain Number 1 Region: 40-256
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.5e-18
Family WD40-repeat 0.0086
Further Details:      
 

Protein sequence

External link(s) Locus: YDR398W   Protein: S000002806
Sequence length 643
Comment UTP5 SGDID:S000002806, Chr IV from 1267464-1269395, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MDSPVLQSAYDPSGQYLCYVTVALDKQRVGVQPTQRATSSGVDTVWNENFLYLEDSKLKV
TCLKWVNLASSDTVAIILGMNNGEIWLYSVLANEVTYKFTTGNSYEIKDIDLMGNQLWCI
DSSDAFYQFDLLQFKLLQHFRINNCVQLNKLTIVPAGDSVAQLLVASHSISLIDIEEKKV
VMTFPGHVSPVSTLQVITNEFFISGAEGDRFLNVYDIHSGMTKCVLVAESDIKELSHSGQ
ADSIAVTTEDGSLEIFVDPLVSSSTKKRGNKSKKSSKKIQIVSKDGRKVPIYNAFINKDL
LNVSWLQNATMPYFKNLQWREIPNEYTVEISLNWNNKNKSADRDLHGKDLASATNYVEGN
ARVTSGDNFKHVDDAIKSWERELTSLEQEQAKPPQANELLTETFGDKLESSTVARISGKK
TNLKGSNLKTATTTGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKPALAVIL
LERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSTLSSLHSTLKRRSDLLPRL
LALDARLDCTINKFKTLNYEAGDIHSSEPVVEEDEDDVEYNEELDDAGLIEDGEESYGSE
EEEEGDSDNEEEQKHTSSKQDGRLETEQSDGEEEAGYSDVEME
Download sequence
Identical sequences Q04177
YDR398W YDR398W 4932.YDR398W YDR398W YDR398W

Jump to [ Top of page · Domain architecture · Domain assignment details ]