SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR398W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR398W
Domain Number 1 Region: 40-256
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.5e-18
Family WD40-repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.692 28.82
regulation of morphogenesis of an epithelium 1.94 28.82
kidney development 1.51 24.61
renal tubule development 2.068 24.61
rRNA metabolic process 2.134 24.37
cilium assembly 1.427 22.48
digestive tract development 2.035 22.18
RNA processing 1.497 18.33
chromosome organization 1.49 16.62
microtubule-based movement 2.011 16.19

Protein sequence

External link(s) Locus: YDR398W   Protein: S000002806
Sequence length 643
Comment UTP5 SGDID:S000002806, Chr IV from 1267464-1269395, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MDSPVLQSAYDPSGQYLCYVTVALDKQRVGVQPTQRATSSGVDTVWNENFLYLEDSKLKV
TCLKWVNLASSDTVAIILGMNNGEIWLYSVLANEVTYKFTTGNSYEIKDIDLMGNQLWCI
DSSDAFYQFDLLQFKLLQHFRINNCVQLNKLTIVPAGDSVAQLLVASHSISLIDIEEKKV
VMTFPGHVSPVSTLQVITNEFFISGAEGDRFLNVYDIHSGMTKCVLVAESDIKELSHSGQ
ADSIAVTTEDGSLEIFVDPLVSSSTKKRGNKSKKSSKKIQIVSKDGRKVPIYNAFINKDL
LNVSWLQNATMPYFKNLQWREIPNEYTVEISLNWNNKNKSADRDLHGKDLASATNYVEGN
ARVTSGDNFKHVDDAIKSWERELTSLEQEQAKPPQANELLTETFGDKLESSTVARISGKK
TNLKGSNLKTATTTGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKPALAVIL
LERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSTLSSLHSTLKRRSDLLPRL
LALDARLDCTINKFKTLNYEAGDIHSSEPVVEEDEDDVEYNEELDDAGLIEDGEESYGSE
EEEEGDSDNEEEQKHTSSKQDGRLETEQSDGEEEAGYSDVEME
Download sequence
Identical sequences N1P753 Q04177
YDR398W 4932.YDR398W YDR398W YDR398W YDR398W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]