SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR398W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR398W
Domain Number 1 Region: 40-256
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.5e-18
Family WD40-repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
microtubule-based process 1.533 14.77
sulfur compound metabolic process 1.496 14.2
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78

Protein sequence

External link(s) Locus: YDR398W   Protein: S000002806
Sequence length 643
Comment UTP5 SGDID:S000002806, Chr IV from 1267464-1269395, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MDSPVLQSAYDPSGQYLCYVTVALDKQRVGVQPTQRATSSGVDTVWNENFLYLEDSKLKV
TCLKWVNLASSDTVAIILGMNNGEIWLYSVLANEVTYKFTTGNSYEIKDIDLMGNQLWCI
DSSDAFYQFDLLQFKLLQHFRINNCVQLNKLTIVPAGDSVAQLLVASHSISLIDIEEKKV
VMTFPGHVSPVSTLQVITNEFFISGAEGDRFLNVYDIHSGMTKCVLVAESDIKELSHSGQ
ADSIAVTTEDGSLEIFVDPLVSSSTKKRGNKSKKSSKKIQIVSKDGRKVPIYNAFINKDL
LNVSWLQNATMPYFKNLQWREIPNEYTVEISLNWNNKNKSADRDLHGKDLASATNYVEGN
ARVTSGDNFKHVDDAIKSWERELTSLEQEQAKPPQANELLTETFGDKLESSTVARISGKK
TNLKGSNLKTATTTGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKPALAVIL
LERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSTLSSLHSTLKRRSDLLPRL
LALDARLDCTINKFKTLNYEAGDIHSSEPVVEEDEDDVEYNEELDDAGLIEDGEESYGSE
EEEEGDSDNEEEQKHTSSKQDGRLETEQSDGEEEAGYSDVEME
Download sequence
Identical sequences N1P753 Q04177
YDR398W YDR398W YDR398W 4932.YDR398W YDR398W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]