SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR432W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR432W
Domain Number 1 Region: 87-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-23
Family Canonical RBD 0.011
Further Details:      
 
Domain Number 2 Region: 198-286
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.37e-13
Family Canonical RBD 0.0042
Further Details:      
 

Protein sequence

External link(s) Locus: YDR432W   Protein: S000002840
Sequence length 414
Comment NPL3 SGDID:S000002840, Chr IV from 1328776-1330020, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; dissociation from mRNAs is promoted by Mtr10p; phosphorylated by Sky1p in the cytoplasm"
Sequence
MSEAQETHVEQLPESVVDAPVEEQHQEPPQAPDAPQEPQVPQESAPQESAPQEPPAPQEQ
NDVPPPSNAPIYEGEESHSVQDYQEAHQHHQPPEPQPYYPPPPPGEHMHGRPPMHHRQEG
ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHG
KSFANQPLEVVYSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGT
GALEFPSEEILVEALERLNNIEFRGSVITVERDDNPPPIRRSNRGGFRGRGGFRGGFRGG
FRGGFSRGGFGGPRGGFGGPRGGYGGYSRGGYGGYSRGGYGGSRGGYDSPRGGYDSPRGG
YSRGGYGGPRNDYGPPRGSYGGSRGGYDGPRGDYGPPRDAYRTRDAPRERSPTR
Download sequence
Identical sequences A6ZZ27 B3LFM6 C8Z5Z3 E7KBB7 E7KM65 E7QDJ5 H0GEN4 Q01560
YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W 4932.YDR432W YDR432W SCRT_00104 YDR432W tr|A6ZZ27|A6ZZ27_YEAS7 YDR432W YDR432W YDR432W YDR432W YDR432W

Jump to [ Top of page · Domain architecture · Domain assignment details ]