SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR432W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR432W
Domain Number 1 Region: 87-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-23
Family Canonical RBD 0.011
Further Details:      
 
Domain Number 2 Region: 198-286
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000837
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spliceosomal complex 1.903 51.59
intracellular ribonucleoprotein complex 1.323 46.1
nucleoplasm part 1.424 30.66
nuclear body 1.842 30.66
cytoplasmic ribonucleoprotein granule 1.909 21.98
cytoplasmic region 1.533 10.23
postsynapse 1.608 10.07
neuromuscular junction 1.903 10.07
chromosomal part 1.471 9.71
nuclear chromosome 1.727 9.71

Protein sequence

External link(s) Locus: YDR432W   Protein: S000002840
Sequence length 414
Comment NPL3 SGDID:S000002840, Chr IV from 1328776-1330020, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; dissociation from mRNAs is promoted by Mtr10p; phosphorylated by Sky1p in the cytoplasm"
Sequence
MSEAQETHVEQLPESVVDAPVEEQHQEPPQAPDAPQEPQVPQESAPQESAPQEPPAPQEQ
NDVPPPSNAPIYEGEESHSVQDYQEAHQHHQPPEPQPYYPPPPPGEHMHGRPPMHHRQEG
ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHG
KSFANQPLEVVYSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGT
GALEFPSEEILVEALERLNNIEFRGSVITVERDDNPPPIRRSNRGGFRGRGGFRGGFRGG
FRGGFSRGGFGGPRGGFGGPRGGYGGYSRGGYGGYSRGGYGGSRGGYDSPRGGYDSPRGG
YSRGGYGGPRNDYGPPRGSYGGSRGGYDGPRGDYGPPRDAYRTRDAPRERSPTR
Download sequence
Identical sequences A6ZZ27 B3LFM6 C8Z5Z3 E7KBB7 E7KM65 E7QDJ5 H0GEN4 N1P7H2 Q01560 W7PN20
YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W YDR432W 4932.YDR432W YDR432W YDR432W YDR432W YDR432W SCRT_00104 YDR432W YDR432W YDR432W tr|A6ZZ27|A6ZZ27_YEAS7 YDR432W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]