SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR477W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR477W
Domain Number 1 Region: 52-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-98
Family Protein kinases, catalytic subunit 0.00000874
Further Details:      
 
Domain Number 2 Region: 460-629
Classification Level Classification E-value
Superfamily KA1-like 5.01e-56
Family Ssp2 C-terminal domain-like 0.00000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR477W   Protein: S000002885
Sequence length 633
Comment SNF1 SGDID:S000002885, Chr IV from 1412366-1414267, Verified ORF, "AMP-activated serine/threonine protein kinase found in a complex containing Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis"
Sequence
MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKT
LGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKP
ENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGV
ILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEI
MQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEK
DEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQ
SKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRA
NMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEED
LWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVS
NISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN
Download sequence
Identical sequences A0A0L8VUK1 A0A250W8H5 A6ZZ66 B5VH05 E7KBE0 E7Q2R2 E7QDE9 G2WBK6 N1PAK9 P06782
YDR477W YDR477W YDR477W YDR477W YDR477W NP_010765.3.97178 YDR477W YDR477W tr|A6ZZ66|A6ZZ66_YEAS7 YDR477W YDR477W YDR477W 4932.YDR477W YDR477W YDR477W YDR477W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]