SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR509W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR509W   Protein: S000002917
Sequence length 115
Comment YDR509W SGDID:S000002917, Chr IV from 1468219-1468566, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MMFTFIFHIFNGFFHCFFKIFYFIFRFYRANLFFLWLYFLHLVMGNIVKVVTIHIHIRAS
LIIPPMASITKRHNVQYLILYKLLEKAIVFFSYTKKKKHKAPITLNFEEARKEYV
Download sequence
Identical sequences P87272
YDR509W 4932.YDR509W YDR509W YDR509W YDR509W

Jump to [ Top of page · Domain architecture · Domain assignment details ]