SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR509W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR509W   Protein: S000002917
Sequence length 115
Comment YDR509W SGDID:S000002917, Chr IV from 1468219-1468566, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MMFTFIFHIFNGFFHCFFKIFYFIFRFYRANLFFLWLYFLHLVMGNIVKVVTIHIHIRAS
LIIPPMASITKRHNVQYLILYKLLEKAIVFFSYTKKKKHKAPITLNFEEARKEYV
Download sequence
Identical sequences P87272
YDR509W 4932.YDR509W YDR509W YDR509W YDR509W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]