SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR529C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR529C
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 3.79e-46
Family 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
oxidoreductase complex 1.774 19.13
transporter complex 1.657 19.05
mitochondrial envelope 1.593 17.94
organelle inner membrane 1.692 15.28
mitochondrial respiratory chain 2.098 5.56
inner mitochondrial membrane protein complex 1.909 4.86
respiratory chain complex 2.02 3.32

Protein sequence

External link(s) Locus: YDR529C   Protein: S000002937
Sequence length 127
Comment QCR7 SGDID:S000002937, Chr IV from 1496541-1496158, reverse complement, Verified ORF, "Subunit 7 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; oriented facing the mitochondrial matrix; N-terminus appears to play a role in complex assembly"
Sequence
MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTAL
RRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDEL
DNIEVSK
Download sequence
Identical sequences A6ZZB6 B3LFE2 C7GKW0 C8Z689 E7KBH3 E7NGF1 E7Q2T8 E7QDI3 G2WBQ6 H0GEV3 N1P5Y3 P00128 W7PN86 W7R4L0
YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C SCRT_00014 tr|A6ZZB6|A6ZZB6_YEAS7 2ibzF YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C 2ibz.F YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C 4932.YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C YDR529C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]