SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR543C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR543C
Domain Number - Region: 8-57
Classification Level Classification E-value
Superfamily YbiA-like 0.0101
Family YbiA-like 0.042
Further Details:      
 

Protein sequence

External link(s) Locus: YDR543C   Protein: S000002951
Sequence length 99
Comment YDR543C SGDID:S000002951, Chr IV from 1524919-1524620, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MAHLSLNQYKCTHIIIHGTCLSGLYPVPFTHNAHDYPHFNIYISFGGPKYCKTALNTYVI
PLLHRILTTQFIYTYANITEKSPPKSPKHKNILSFNNNT
Download sequence
Identical sequences Q03051
YDR543C YDR543C 4932.YDR543C YDR543C YDR543C

Jump to [ Top of page · Domain architecture · Domain assignment details ]