SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR543C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR543C
Domain Number - Region: 8-57
Classification Level Classification E-value
Superfamily YbiA-like 0.0101
Family YbiA-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR543C   Protein: S000002951
Sequence length 99
Comment YDR543C SGDID:S000002951, Chr IV from 1524919-1524620, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MAHLSLNQYKCTHIIIHGTCLSGLYPVPFTHNAHDYPHFNIYISFGGPKYCKTALNTYVI
PLLHRILTTQFIYTYANITEKSPPKSPKHKNILSFNNNT
Download sequence
Identical sequences Q03051
YDR543C YDR543C 4932.YDR543C YDR543C YDR543C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]