SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR544C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR544C   Protein: S000002952
Sequence length 142
Comment YDR544C SGDID:S000002952, Chr IV from 1525509-1525081, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIHTTPHPHTPHHTHHTHTTPTPTPHPHTHTPTPERSLSLRLR
QAKPDQPVSQITLHYPTSPLVTLTHSTIPPQPPSISLCTTTNRPSTITVTLQLPISNSTT
TYPTISHLLLTILLFYPPLLKR
Download sequence
Identical sequences Q03057
YDR544C 4932.YDR544C YDR544C YDR544C

Jump to [ Top of page · Domain architecture · Domain assignment details ]