SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR544C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR544C   Protein: S000002952
Sequence length 142
Comment YDR544C SGDID:S000002952, Chr IV from 1525509-1525081, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIHTTPHPHTPHHTHHTHTTPTPTPHPHTHTPTPERSLSLRLR
QAKPDQPVSQITLHYPTSPLVTLTHSTIPPQPPSISLCTTTNRPSTITVTLQLPISNSTT
TYPTISHLLLTILLFYPPLLKR
Download sequence
Identical sequences Q03057
YDR544C 4932.YDR544C YDR544C YDR544C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]