SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL002C   Protein: S000000728
Sequence length 430
Comment WBP1 SGDID:S000000728, Chr V from 150013-148721, reverse complement, Verified ORF, "Beta subunit of the oligosaccharyl transferase (OST) glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum"
Sequence
MRTDWNFFFCILLQAIFVVGTQTSRTLVLYDQSTEPLEEYSVYLKDLEQRNYKLEYLDIN
STSTTVDLYDKEQRLFDNIIVFPTKGGKNLARQIPVKQLIKFFENEGNILCMSSPGAVPN
TIRLFLNELGIYPSPKGHVIRDYFSPSSEELVVSSNHLLNKYVYNARKSEDFVFGESSAA
LLENREQIVPILNAPRTSFTESKGKCNSWTSGSQGFLVVGFQNLNNARLVWIGSSDFLKN
KNQDSNQEFAKELLKWTFNEKSVIKSVHAVHSHADGTSYDEEPYKIKDKVIYSVGFSEWN
GEEWLPHIADDIQFELRQVDPYYRLTLSPSGNDSETQYYTTGEFILPDRHGVFTFLTDYR
KIGLSFTTDKDVKAIRHLANDEYPRSWEISNSWVYISAICGVIVAWIFFVVSFVTTSSVG
KKLETFKKTN
Download sequence
Identical sequences B3LS10 B5VHD0 C8Z6Z7 N1PA79 P33767 W7PUF8 W7RFS6
YEL002C 4932.YEL002C YEL002C YEL002C SCRT_04466 YEL002C YEL002C YEL002C YEL002C YEL002c___KOG2754 YEL002C YEL002C

Jump to [ Top of page · Domain architecture · Domain assignment details ]