SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL002C   Protein: S000000728
Sequence length 430
Comment WBP1 SGDID:S000000728, Chr V from 150013-148721, reverse complement, Verified ORF, "Beta subunit of the oligosaccharyl transferase (OST) glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum"
Sequence
MRTDWNFFFCILLQAIFVVGTQTSRTLVLYDQSTEPLEEYSVYLKDLEQRNYKLEYLDIN
STSTTVDLYDKEQRLFDNIIVFPTKGGKNLARQIPVKQLIKFFENEGNILCMSSPGAVPN
TIRLFLNELGIYPSPKGHVIRDYFSPSSEELVVSSNHLLNKYVYNARKSEDFVFGESSAA
LLENREQIVPILNAPRTSFTESKGKCNSWTSGSQGFLVVGFQNLNNARLVWIGSSDFLKN
KNQDSNQEFAKELLKWTFNEKSVIKSVHAVHSHADGTSYDEEPYKIKDKVIYSVGFSEWN
GEEWLPHIADDIQFELRQVDPYYRLTLSPSGNDSETQYYTTGEFILPDRHGVFTFLTDYR
KIGLSFTTDKDVKAIRHLANDEYPRSWEISNSWVYISAICGVIVAWIFFVVSFVTTSSVG
KKLETFKKTN
Download sequence
Identical sequences B3LS10 B5VHD0 C8Z6Z7 N1PA79 P33767 W7PUF8 W7RFS6
4932.YEL002C YEL002C YEL002C SCRT_04466 YEL002C YEL002c___KOG2754 YEL002C YEL002C YEL002C YEL002C YEL002C YEL002C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]