SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YEL009C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL009C
Domain Number 1 Region: 225-279
Classification Level Classification E-value
Superfamily Leucine zipper domain 7.38e-19
Family Leucine zipper domain 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transcription factor complex 1.881 33.34
nucleoplasm part 1.419 8.27

Protein sequence

External link(s) Locus: YEL009C   Protein: S000000735
Sequence length 281
Comment GCN4 SGDID:S000000735, Chr V from 139763-138918, reverse complement, Verified ORF, "Transcriptional activator of amino acid biosynthetic genes in response to amino acid starvation; expression is tightly regulated at both the transcriptional and translational levels"
Sequence
MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQD
TPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEW
TSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVK
KPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR
RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Download sequence
Identical sequences N1P3V4 P03069 W7PUF5
4932.YEL009C YEL009C YEL009C YEL009C YEL009C YEL009C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]