SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL009C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL009C
Domain Number 1 Region: 225-279
Classification Level Classification E-value
Superfamily Leucine zipper domain 7.38e-19
Family Leucine zipper domain 6.03e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YEL009C   Protein: S000000735
Sequence length 281
Comment GCN4 SGDID:S000000735, Chr V from 139763-138918, reverse complement, Verified ORF, "Transcriptional activator of amino acid biosynthetic genes in response to amino acid starvation; expression is tightly regulated at both the transcriptional and translational levels"
Sequence
MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQD
TPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEW
TSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVK
KPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR
RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Download sequence
Identical sequences P03069
YEL009C YEL009C 4932.YEL009C YEL009C YEL009C YEL009C

Jump to [ Top of page · Domain architecture · Domain assignment details ]