SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL011W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL011W
Domain Number 1 Region: 196-576
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.7e-84
Family Amylase, catalytic domain 4.84e-05
Further Details:      
 
Domain Number 2 Region: 605-703
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.51e-28
Family alpha-Amylases, C-terminal beta-sheet domain 0.0071
Further Details:      
 
Domain Number 3 Region: 57-159
Classification Level Classification E-value
Superfamily E set domains 8.75e-15
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 

Protein sequence

External link(s) Locus: YEL011W   Protein: S000000737
Sequence length 704
Comment GLC3 SGDID:S000000737, Chr V from 133120-135234, Verified ORF, "Glycogen branching enzyme, involved in glycogen accumulation; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern"
Sequence
MYNIPDNVKGAVEFDPWLKPFADVLSERRYLADKWLYDITHATPDGSYQSLSKFARDSYK
SYGLHANPETKEITYKEWAPNAERAFLVGDFNNWDTTSHELKNKDEFGNFTITLHPLPNG
DFAIPHDSKIKVMFILPDGSKIFRLPAWITRATQPSKETSKQFGPAYEGRFWNPENPYKF
VHPRPKFSESVDSLRIYEAHVGISSPEPKITTYKEFTEKVLPRIKYLGYDAIQLMAIMEH
AYYASFGYQVTNFFAASSRFGTPEELKELIDTAHSMGILVLLDVVHSHASKNVEDGLNMF
DGSDHQYFHSISSGRGEHPLWDSRLFNYGKFEVQRFLLANLAFYVDVYQFDGFRFDGVTS
MLYVHHGVGAGGSFSGDYNEYLSRDRSFVDHEALAYLMLANDLVHEMLPNLAVTVAEDVS
GYPTLCLPRSIGGTGFDYRLAMALPDMWIKLIKEKKDDEWEMGSIVYTLTNRRYGEKVVA
YCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPSIVIDRGIALHKMIRLITHSLGGEAY
LNFEGNEFGHPEWLDFPNVNNGDSYKYARRQFNLADDPLLRYQNLNEFDRSMQLCEKRHK
WLNTKQAYVSLKHEGDKMIVFERNNLLFIFNFHPTNSYSDYRVGVEKAGTYHIVLNSDRA
EFGGHNRINESSEFFTTDLEWNNRKNFLQVYIPSRVALVLALKE
Download sequence
Identical sequences N1P5D9 P32775
YEL011W YEL011W YEL011W 4932.YEL011W YEL011W YEL011W YEL011W

Jump to [ Top of page · Domain architecture · Domain assignment details ]