SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YEL011W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL011W
Domain Number 1 Region: 196-576
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.7e-84
Family Amylase, catalytic domain 0.0000484
Further Details:      
 
Domain Number 2 Region: 605-703
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.51e-28
Family alpha-Amylases, C-terminal beta-sheet domain 0.0071
Further Details:      
 
Domain Number 3 Region: 57-159
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000875
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
receptor complex 1.51 25.82
extracellular space 1.523 24.02
external encapsulating structure 1.632 21.56
endoplasmic reticulum part 1.429 19.07
integral to plasma membrane 1.469 16.65
plastid 1.6 12.63
microvillus 1.896 10.4
cation channel complex 2.038 9.34
nucleoplasm part 1.419 8.47
transcription factor complex 1.881 8.47

Protein sequence

External link(s) Locus: YEL011W   Protein: S000000737
Sequence length 704
Comment GLC3 SGDID:S000000737, Chr V from 133120-135234, Verified ORF, "Glycogen branching enzyme, involved in glycogen accumulation; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern"
Sequence
MYNIPDNVKGAVEFDPWLKPFADVLSERRYLADKWLYDITHATPDGSYQSLSKFARDSYK
SYGLHANPETKEITYKEWAPNAERAFLVGDFNNWDTTSHELKNKDEFGNFTITLHPLPNG
DFAIPHDSKIKVMFILPDGSKIFRLPAWITRATQPSKETSKQFGPAYEGRFWNPENPYKF
VHPRPKFSESVDSLRIYEAHVGISSPEPKITTYKEFTEKVLPRIKYLGYDAIQLMAIMEH
AYYASFGYQVTNFFAASSRFGTPEELKELIDTAHSMGILVLLDVVHSHASKNVEDGLNMF
DGSDHQYFHSISSGRGEHPLWDSRLFNYGKFEVQRFLLANLAFYVDVYQFDGFRFDGVTS
MLYVHHGVGAGGSFSGDYNEYLSRDRSFVDHEALAYLMLANDLVHEMLPNLAVTVAEDVS
GYPTLCLPRSIGGTGFDYRLAMALPDMWIKLIKEKKDDEWEMGSIVYTLTNRRYGEKVVA
YCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPSIVIDRGIALHKMIRLITHSLGGEAY
LNFEGNEFGHPEWLDFPNVNNGDSYKYARRQFNLADDPLLRYQNLNEFDRSMQLCEKRHK
WLNTKQAYVSLKHEGDKMIVFERNNLLFIFNFHPTNSYSDYRVGVEKAGTYHIVLNSDRA
EFGGHNRINESSEFFTTDLEWNNRKNFLQVYIPSRVALVLALKE
Download sequence
Identical sequences N1P5D9 P32775
YEL011W YEL011W YEL011W YEL011W YEL011W YEL011W 4932.YEL011W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]