SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL020C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YEL020C-B
Domain Number - Region: 29-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL020C-B   Protein: S000028544
Sequence length 65
Comment YEL020C-B SGDID:S000028544, Chr V from 117380-117183, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; partially overlaps verified gene YEL020W-A; identified by fungal homology and RT-PCR"
Sequence
MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCSLEFNASIFTV
LSYCS
Download sequence
Identical sequences C8Z6X6 P0C5M6 W7PHY2
YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B 4932.YEL020C-B YEL020C-B YEL020C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]