SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL020C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YEL020C-B
Domain Number - Region: 29-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YEL020C-B   Protein: S000028544
Sequence length 65
Comment YEL020C-B SGDID:S000028544, Chr V from 117380-117183, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; partially overlaps verified gene YEL020W-A; identified by fungal homology and RT-PCR"
Sequence
MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCSLEFNASIFTV
LSYCS
Download sequence
Identical sequences C8Z6X6 P0C5M6
YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B 4932.YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B YEL020C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]