SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL034C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL034C-A   Protein: S000028743
Sequence length 200
Comment YEL034C-A SGDID:S000028743, Chr V from 86215-85613, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data; completely overlaps HYP2/YEL034W, a verified gene that encodes eiF-5A"
Sequence
MEGASEFFFLFSFISHAMMLTGLIGSSSFLEGDGGFFTHSGDDGNHQVLTFIKSSLQTVT
QFTFWSLDIILSVTVHVHQRQETVINVQQLVFVSLDNWNFHVVSRWRQIFQLLTSEDING
NQMDFSVTVLTSLRSGHVDNLTWSTLDDNETVLSQGRTLHWVGGGGTSVSSFKGMFFVRH
CIYELVFVCVWESMSNWLQK
Download sequence
Identical sequences Q02217
YEL034C-A YEL034C-A 4932.YEL034C-A YEL034C-A YEL034C-A YEL034C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]