SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL034C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL034C-A   Protein: S000028743
Sequence length 200
Comment YEL034C-A SGDID:S000028743, Chr V from 86215-85613, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data; completely overlaps HYP2/YEL034W, a verified gene that encodes eiF-5A"
Sequence
MEGASEFFFLFSFISHAMMLTGLIGSSSFLEGDGGFFTHSGDDGNHQVLTFIKSSLQTVT
QFTFWSLDIILSVTVHVHQRQETVINVQQLVFVSLDNWNFHVVSRWRQIFQLLTSEDING
NQMDFSVTVLTSLRSGHVDNLTWSTLDDNETVLSQGRTLHWVGGGGTSVSSFKGMFFVRH
CIYELVFVCVWESMSNWLQK
Download sequence
Identical sequences Q02217
YEL034C-A YEL034C-A YEL034C-A 4932.YEL034C-A YEL034C-A YEL034C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]