SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL034W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL034W
Domain Number 1 Region: 14-92
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.01e-29
Family eIF5a N-terminal domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 85-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.68e-24
Family Cold shock DNA-binding domain-like 0.00097
Further Details:      
 

Protein sequence

External link(s) Locus: YEL034W   Protein: S000000760
Sequence length 157
Comment HYP2 SGDID:S000000760, Chr V from 85676-86149, Verified ORF, "Translation initiation factor eIF-5A, promotes formation of the first peptide bond; similar to and functionally redundant with Anb1p; possible role in translation elongation; undergoes an essential hypusination modification"
Sequence
MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLV
AIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGEL
GDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Download sequence
Identical sequences A6ZQR6 B3LRY3 C8Z6W1 E7KBK6 E7KMG8 E7LTL9 E7NGS5 E7Q360 E7QDP3 H0GFD5 N1P3S8 P23301 W7PVK9
YEL034W YEL034W YEL034W YEL034W YEL034W YEL034W YEL034W YEL034W YEL034W YEL034W 4932.YEL034W YEL034W SCRT_04437 YEL034W YEL034W tr|A6ZQR6|A6ZQR6_YEAS7 YEL034W YEL034W YEL034W YEL034W YEL034w___KOG3271 YEL034W

Jump to [ Top of page · Domain architecture · Domain assignment details ]