SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL039C
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily Cytochrome c 6.54e-33
Family monodomain cytochrome c 1.48e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YEL039C   Protein: S000000765
Sequence length 113
Comment CYC7 SGDID:S000000765, Chr V from 79977-79636, reverse complement, Verified ORF, "Cytochrome c isoform 2, expressed under hypoxic conditions; electron carrier of the mitochondrial intermembrane space that transfers electrons from ubiquinone-cytochrome c oxidoreductase to cytochrome c oxidase during cellular respiration"
Sequence
MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTD
ANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK
Download sequence
Identical sequences A6ZQR1 B3LRX8 C7GKE2 C8Z6V5 E7KBK3 E7KMG4 E7LTL7 E7Q351 G2WCJ4 H0GFD1 N1P3S2 P00045 W7PVK6 W7QZV2
YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C 4932.YEL039C YEL039C SCRT_04432 YEL039C YEL039C tr|A6ZQR1|A6ZQR1_YEAS7 YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C YEL039C

Jump to [ Top of page · Domain architecture · Domain assignment details ]