SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YEL045C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL045C   Protein: S000000771
Sequence length 141
Comment YEL045C SGDID:S000000771, Chr V from 69265-68840, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein based on available experimental and comparative sequence data; deletion gives MMS sensitivity, growth defect under alkaline conditions, less than optimal growth upon citric acid stress"
Sequence
MKCHAKRTLAFLATALPLSGKSRACTRTPQSFASGFRAAAPFLFSRCFALCITHCALFHL
PYSFTGFSFYFFVFFRLFLHWIYAFCICNSTYVYIYKQVLSLPVKSSMCPSRLSCSVWYR
VILTYIYVHCFRWLVRNHLLS
Download sequence
Identical sequences B5VH90 C8Z6U9 E7KBJ9 H0GFC5 P32616
4932.YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]