SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL045C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL045C   Protein: S000000771
Sequence length 141
Comment YEL045C SGDID:S000000771, Chr V from 69265-68840, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein based on available experimental and comparative sequence data; deletion gives MMS sensitivity, growth defect under alkaline conditions, less than optimal growth upon citric acid stress"
Sequence
MKCHAKRTLAFLATALPLSGKSRACTRTPQSFASGFRAAAPFLFSRCFALCITHCALFHL
PYSFTGFSFYFFVFFRLFLHWIYAFCICNSTYVYIYKQVLSLPVKSSMCPSRLSCSVWYR
VILTYIYVHCFRWLVRNHLLS
Download sequence
Identical sequences B5VH90 C8Z6U9 E7KBJ9 H0GFC5 P32616
YEL045C YEL045C 4932.YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C YEL045C

Jump to [ Top of page · Domain architecture · Domain assignment details ]