SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL050W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL050W-A   Protein: S000028545
Sequence length 63
Comment YEL050W-A SGDID:S000028545, Chr V from 59549-59740, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, identified by fungal homology and RT-PCR"
Sequence
MIVDKRHCLQAVQNYIVQINVTRTTKKRSLCCFFSTKISLFIILHLCLLVCLLLSFYFDF
YPF
Download sequence
Identical sequences P0C5M7
YEL050W-A 4932.YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]