SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL050W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL050W-A   Protein: S000028545
Sequence length 63
Comment YEL050W-A SGDID:S000028545, Chr V from 59549-59740, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, identified by fungal homology and RT-PCR"
Sequence
MIVDKRHCLQAVQNYIVQINVTRTTKKRSLCCFFSTKISLFIILHLCLLVCLLLSFYFDF
YPF
Download sequence
Identical sequences P0C5M7
YEL050W-A YEL050W-A 4932.YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A YEL050W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]