SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL051W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YEL051W
Domain Number - Region: 81-178
Classification Level Classification E-value
Superfamily Tp47 lipoprotein, N-terminal domain 0.00327
Family Tp47 lipoprotein, N-terminal domain 0.0037
Further Details:      
 

Protein sequence

External link(s) Locus: YEL051W   Protein: S000000777
Sequence length 256
Comment VMA8 SGDID:S000000777, Chr V from 58378-59148, Verified ORF, "Subunit D of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; plays a role in the coupling of proton transport and ATP hydrolysis"
Sequence
MSGNREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFRDITKRIDDAKQKMGRV
MQTAAFSLAEVSYATGENIGYQVQESVSTARFKVRARQENVSGVYLSQFESYIDPEINDF
RLTGLGRGGQQVQRAKEIYSRAVETLVELASLQTAFIILDEVIKVTNRRVNAIEHVIIPR
TENTIAYINSELDELDREEFYRLKKVQEKKQNETAKLDAEMKLKRDRAEQDASEVAADEE
PQGETLVADQEDDVIF
Download sequence
Identical sequences A6ZQQ0 B3LRW6 B5VH86 C7GXD8 C8Z6U2 G2WCI3 P32610
YEL051W YEL051W YEL051W YEL051W YEL051W YEL051W YEL051W YEL051W YEL051W YR23 YEL051W YEL051W YEL051W YEL051W 4932.YEL051W YEL051W SCRT_04420 YEL051W YEL051W tr|A6ZQQ0|A6ZQQ0_YEAS7 YEL051W YEL051W YEL051w___KOG1647 YEL051W YEL051W YEL051W YEL051W YEL051W

Jump to [ Top of page · Domain architecture · Domain assignment details ]