SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL053W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL053W-A   Protein: S000028744
Sequence length 115
Comment YEL053W-A SGDID:S000028744, Chr V from 52908-53255, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YEL054C"
Sequence
MLPLCLTFLSFFLSLGGSFKAVMTKEEADGTTEAAACLFWIFNWTVTLIPLNSLVALAIS
SPTFFGDRPKGPIFGAKAAEAPTSPPTALRYKYLTSLGSNFGGIFVYPLFLLSTF
Download sequence
Identical sequences C8Z6T9
YEL053W-A YEL053W-A ORFP:5933 YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A 4932.YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]