SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YEL053W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL053W-A   Protein: S000028744
Sequence length 115
Comment YEL053W-A SGDID:S000028744, Chr V from 52908-53255, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YEL054C"
Sequence
MLPLCLTFLSFFLSLGGSFKAVMTKEEADGTTEAAACLFWIFNWTVTLIPLNSLVALAIS
SPTFFGDRPKGPIFGAKAAEAPTSPPTALRYKYLTSLGSNFGGIFVYPLFLLSTF
Download sequence
Identical sequences C8Z6T9 W7PVI9
YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A 4932.YEL053W-A YEL053W-A YEL053W-A YEL053W-A YEL053W-A ORFP:5933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]