SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL058W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL058W
Domain Number 1 Region: 464-555
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 4.84e-21
Family Phosphoglucomutase, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 22-114
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.81e-15
Family Phosphoglucomutase, first 3 domains 0.0079
Further Details:      
 
Domain Number 3 Region: 197-307
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.83e-10
Family Phosphoglucomutase, first 3 domains 0.0078
Further Details:      
 
Domain Number 4 Region: 83-181
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-09
Family Phosphoglucomutase, first 3 domains 0.003
Further Details:      
 
Weak hits

Sequence:  YEL058W
Domain Number - Region: 356-449
Classification Level Classification E-value
Superfamily CheC-like 0.00262
Family CheC-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
intramolecular transferase activity 2.226 140.54
isomerase activity 1.669 70.52
Cellular Component IC (bits) H-Score
sarcolemma 1.911 8.74

Protein sequence

External link(s) Locus: YEL058W   Protein: S000000784
Sequence length 557
Comment PCM1 SGDID:S000000784, Chr V from 43252-44925, Verified ORF, "Essential N-acetylglucosamine-phosphate mutase; converts GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the biosynthesis of chitin and for the formation of N-glycosylated mannoproteins and glycosylphosphatidylinositol anchors"
Sequence
MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV
GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH
EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS
NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL
LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD
ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA
YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK
LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC
IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS
KLGQFCDEVVEHVKASA
Download sequence
Identical sequences P38628
YEL058W 4932.YEL058W YEL058W YEL058W YEL058w___KOG2537 355293 YEL058W YEL058W YEL058W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]