SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL058W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL058W
Domain Number 1 Region: 464-555
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 4.84e-21
Family Phosphoglucomutase, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 22-114
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.81e-15
Family Phosphoglucomutase, first 3 domains 0.0079
Further Details:      
 
Domain Number 3 Region: 197-307
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.83e-10
Family Phosphoglucomutase, first 3 domains 0.0078
Further Details:      
 
Domain Number 4 Region: 83-181
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-09
Family Phosphoglucomutase, first 3 domains 0.003
Further Details:      
 
Weak hits

Sequence:  YEL058W
Domain Number - Region: 356-449
Classification Level Classification E-value
Superfamily CheC-like 0.00262
Family CheC-like 0.022
Further Details:      
 

Protein sequence

External link(s) Locus: YEL058W   Protein: S000000784
Sequence length 557
Comment PCM1 SGDID:S000000784, Chr V from 43252-44925, Verified ORF, "Essential N-acetylglucosamine-phosphate mutase; converts GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the biosynthesis of chitin and for the formation of N-glycosylated mannoproteins and glycosylphosphatidylinositol anchors"
Sequence
MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV
GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH
EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS
NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL
LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD
ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA
YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK
LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC
IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS
KLGQFCDEVVEHVKASA
Download sequence
Identical sequences P38628
YEL058W 4932.YEL058W YEL058W YEL058W YEL058w___KOG2537 355293 YEL058W YEL058W YEL058W

Jump to [ Top of page · Domain architecture · Domain assignment details ]