SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL059C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL059C-A   Protein: S000002954
Sequence length 74
Comment SOM1 SGDID:S000002954, Chr V from 42624-42400, reverse complement, Verified ORF, "Subunit of the mitochondrial inner membrane peptidase, which is required for maturation of mitochondrial proteins of the intermembrane space; Som1p facilitates cleavage of a subset of substrates"
Sequence
MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK
SATNYEVTDTYTNS
Download sequence
Identical sequences A6ZQP2 B3LRV9 C7GXE6 C8Z6T2 N1P578 Q05676 W7PVI5 W7R3S7
YEL059C-A YEL059C-A 4932.YEL059C-A YEL059C-A SCRT_04412 YEL059C-A tr|A6ZQP2|A6ZQP2_YEAS7 YEL059C-A YEL059C-A YEL059C-A YEL059C-A YEL059C-A APC6512 YTYst134 YEL059C-A YEL059C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]