SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL059C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL059C-A   Protein: S000002954
Sequence length 74
Comment SOM1 SGDID:S000002954, Chr V from 42624-42400, reverse complement, Verified ORF, "Subunit of the mitochondrial inner membrane peptidase, which is required for maturation of mitochondrial proteins of the intermembrane space; Som1p facilitates cleavage of a subset of substrates"
Sequence
MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK
SATNYEVTDTYTNS
Download sequence
Identical sequences A6ZQP2 B3LRV9 C7GXE6 C8Z6T2 N1P578 Q05676 W7PVI5 W7R3S7
YEL059C-A YEL059C-A 4932.YEL059C-A YEL059C-A SCRT_04412 YEL059C-A tr|A6ZQP2|A6ZQP2_YEAS7 YEL059C-A YEL059C-A YEL059C-A YEL059C-A YEL059C-A APC6512 YTYst134 YEL059C-A YEL059C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]