SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YEL065W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL065W
Domain Number 1 Region: 70-258,337-510,552-573
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-28
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.417 14.48
vacuolar part 1.567 14.15
brush border membrane 1.487 11.03
clathrin-coated vesicle 1.989 10.1
presynapse 1.758 9.56
secretory vesicle 1.539 8.53
exocytic vesicle 2.03 7.81
lytic vacuole 1.553 7.12
intrinsic component of organelle membrane 2.016 6.26
synapse part 1.419 5.81
Biological Process IC (bits) H-Score
nucleobase-containing compound transport 2.039 39.45
ion transport 1.47 36.53
transmembrane transport 1.581 31.84
secretion 1.506 22.79
cellular chemical homeostasis 1.499 16.18
inorganic ion homeostasis 1.494 16.18
cation homeostasis 1.508 16.18
vacuole organization 2.183 16.18
response to organic cyclic compound 1.42 12.27
response to drug 1.512 12.02

Protein sequence

External link(s) Locus: YEL065W   Protein: S000000791
Sequence length 628
Comment SIT1 SGDID:S000000791, Chr V from 27657-29543, Verified ORF, "Ferrioxamine B transporter, member of the ARN family of transporters that specifically recognize siderophore-iron chelates; transcription is induced during iron deprivation and diauxic shift; potentially phosphorylated by Cdc28p"
Sequence
MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY
AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL
EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL
GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV
PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALL
IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTY
TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN
TFEIEEKEESFLKNKFFTHFTSSKDRKD
Download sequence
Identical sequences N1PA34 P39980
YEL065W YEL065W 4932.YEL065W YEL065W YEL065W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]