SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL069C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL069C
Domain Number 1 Region: 60-518
Classification Level Classification E-value
Superfamily MFS general substrate transporter 8.24e-60
Family LacY-like proton/sugar symporter 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
clathrin-coated vesicle 1.877 13.61
cell projection membrane 1.528 11.05
secretory granule 1.827 9.35
vacuole 1.428 8.86
brush border 1.481 8.21
coated vesicle 1.745 8.06
cytoplasmic vesicle membrane 1.923 7.95
transport vesicle 2.075 7.66
synapse part 1.513 6.53
sperm part 2.208 6.33

Protein sequence

External link(s) Locus: YEL069C   Protein: S000000795
Sequence length 564
Comment HXT13 SGDID:S000000795, Chr V from 23231-21537, reverse complement, Verified ORF, "Hexose transporter, induced in the presence of non-fermentable carbon sources, induced by low levels of glucose, repressed by high levels of glucose"
Sequence
MSSAQSSIDSDGDVRDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL
CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA
IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL
CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWAL
IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG
EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG
TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN
AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT
GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG
ISSEESKTEKKDWKKFLKFSKNSD
Download sequence
Identical sequences P39924
YEL069C YEL069C 4932.YEL069C YEL069C YEL069C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]