SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL069C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL069C
Domain Number 1 Region: 60-518
Classification Level Classification E-value
Superfamily MFS general substrate transporter 8.24e-60
Family LacY-like proton/sugar symporter 0.02
Further Details:      
 

Protein sequence

External link(s) Locus: YEL069C   Protein: S000000795
Sequence length 564
Comment HXT13 SGDID:S000000795, Chr V from 23231-21537, reverse complement, Verified ORF, "Hexose transporter, induced in the presence of non-fermentable carbon sources, induced by low levels of glucose, repressed by high levels of glucose"
Sequence
MSSAQSSIDSDGDVRDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL
CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA
IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL
CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWAL
IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG
EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG
TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN
AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT
GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG
ISSEESKTEKKDWKKFLKFSKNSD
Download sequence
Identical sequences P39924
YEL069C YEL069C 4932.YEL069C YEL069C YEL069C

Jump to [ Top of page · Domain architecture · Domain assignment details ]