SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL074W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL074W   Protein: S000000800
Sequence length 112
Comment YEL074W SGDID:S000000800, Chr V from 6126-6464, Dubious ORF, "Hypothetical protein"
Sequence
MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQKDKLLPKCITPPNKKA
DPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPSKSPKHKNILPFNFTK
Download sequence
Identical sequences P39973
YEL074W YEL074W 4932.YEL074W YEL074W YEL074w YEL074W YEL074W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]