SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL074W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL074W   Protein: S000000800
Sequence length 112
Comment YEL074W SGDID:S000000800, Chr V from 6126-6464, Dubious ORF, "Hypothetical protein"
Sequence
MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQKDKLLPKCITPPNKKA
DPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPSKSPKHKNILPFNFTK
Download sequence
Identical sequences P39973
YEL074W YEL074W 4932.YEL074W YEL074W YEL074w YEL074W YEL074W

Jump to [ Top of page · Domain architecture · Domain assignment details ]