SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL075W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YEL075W-A   Protein: S000002956
Sequence length 203
Comment YEL075W-A SGDID:S000002956, Chr V from 4870-5481, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MGSSFVIDRSSSSPAPPRGPAPKLSAHARKIICKISPNRSFLFIISLHICEKYFISMGLR
GHRSRFSRSVSTFFSPGKLACIAHLRVGCQIVPIFPYGAFLKTPYNRCAGNKVSESTHRR
AVVRPSTRYFVTTFQDTETQLIIVSSVEVKKRKGIVILSIEFQSMHLKQRVDHHVVCLKG
LVRPGNLVRLQQTSGTFLHFSRP
Download sequence
Identical sequences P89888
YEL075W-A 4932.YEL075W-A YEL075W-A YEL075W-A YEL075W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]