SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YEL075W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL075W-A   Protein: S000002956
Sequence length 203
Comment YEL075W-A SGDID:S000002956, Chr V from 4870-5481, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MGSSFVIDRSSSSPAPPRGPAPKLSAHARKIICKISPNRSFLFIISLHICEKYFISMGLR
GHRSRFSRSVSTFFSPGKLACIAHLRVGCQIVPIFPYGAFLKTPYNRCAGNKVSESTHRR
AVVRPSTRYFVTTFQDTETQLIIVSSVEVKKRKGIVILSIEFQSMHLKQRVDHHVVCLKG
LVRPGNLVRLQQTSGTFLHFSRP
Download sequence
Identical sequences P89888
4932.YEL075W-A YEL075W-A YEL075W-A YEL075W-A YEL075W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]