SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER006C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER006C-A   Protein: S000028745
Sequence length 105
Comment YER006C-A SGDID:S000028745, Chr V from 164660-164343, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF PAC2"
Sequence
MFSPAVIVPFHPISFYRRPRLNNTYEFDGAKISTNLESVPNFISHAISEIRFAFYILYIL
YMKHNKSWNFLMISLSKEQKGSKTKKNKMYSNEFKSTPIIYSNVI
Download sequence
Identical sequences YER006C-A YER006C-A YER006C-A 4932.YER006C-A YER006C-A YER006C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]