SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER006C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YER006C-A   Protein: S000028745
Sequence length 105
Comment YER006C-A SGDID:S000028745, Chr V from 164660-164343, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF PAC2"
Sequence
MFSPAVIVPFHPISFYRRPRLNNTYEFDGAKISTNLESVPNFISHAISEIRFAFYILYIL
YMKHNKSWNFLMISLSKEQKGSKTKKNKMYSNEFKSTPIIYSNVI
Download sequence
Identical sequences YER006C-A 4932.YER006C-A YER006C-A YER006C-A YER006C-A YER006C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]