SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER012W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER012W
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.92e-52
Family Proteasome subunits 0.00000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytosol 1.295 10.15
intracellular ribonucleoprotein complex 1.368 6.59
cytoplasmic ribonucleoprotein granule 1.929 6.59
ATPase complex 2.002 4.78
extracellular space 1.3 4.56
extracellular exosome 2.052 4.56
extracellular organelle 1.645 4.38

Protein sequence

External link(s) Locus: YER012W   Protein: S000000814
Sequence length 198
Comment PRE1 SGDID:S000000814, Chr V from 177834-178430, Verified ORF, "Beta 4 subunit of the 20S proteasome; localizes to the nucleus throughout the cell cycle"
Sequence
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI
QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID
YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVI
VKIVDKDGIRQVDDFQAQ
Download sequence
Identical sequences A0A0L8VRW5 B3LS24 B5VHE3 C7GKJ0 C8Z712 E7KBN2 E7KMK1 E7LTQ2 E7NGZ9 E7QDS7 G2WCP3 H0GEZ9 N1PA82 P22141
YER012W SCRT_04480 YER012W YER012W YER012W YER012W 000007816|e1rypK1|210.1.1.2|K:1-198 000086926|e1rypY1|210.1.1.2|Y:1-198 000086928|e2zcyX1|210.1.1.2|X:1-198 000086929|e3bdmX1|210.1.1.2|X:1-198 000086930|e1g0uX1|210.1.1.2|X:1-198 000086931|e3bdmJ1|210.1.1.2|J:1-198 000086933|e1jd2J1|210.1.1.2|J:1-198 000086935|e2zcyJ1|210.1.1.2|J:1-198 000086936|e1g65X1|210.1.1.2|X:1-198 000086938|e1jd2Q1|210.1.1.2|Q:1-198 000086940|e3e47X1|210.1.1.2|X:1-198 000086944|e3e47J1|210.1.1.2|J:1-198 000086945|e1g65J1|210.1.1.2|J:1-198 000086948|e3d29J1|210.1.1.2|J:1-198 000086949|e3d29X1|210.1.1.2|X:1-198 000086950|e1g0uJ1|210.1.1.2|J:1-198 000139535|e1vsyK1|210.1.1.2|K:1-198 000148341|e3un4J1|210.1.1.2|J:1-198 000150613|e3sdiJ1|210.1.1.2|J:1-198 000152310|e4gk7J1|210.1.1.2|J:1-198 000152373|e4b4t41|210.1.1.2|4:1-198 000153342|e4fzcJ1|210.1.1.2|J:1-198 000181716|e3oeuJ1|210.1.1.2|J:1-198 000222431|e4inrJ1|210.1.1.2|J:1-198 000224774|e4j70J1|210.1.1.2|J:1-198 000351416|e3dy3J1|210.1.1.2|J:1-198 000351417|e3dy3X1|210.1.1.2|X:1-198 000351444|e3dy4J1|210.1.1.2|J:1-198 000351445|e3dy4X1|210.1.1.2|X:1-198 000364525|e3gpjJ1|210.1.1.2|J:1-198 000364526|e3gpjX1|210.1.1.2|X:1-198 000372527|e3gptJ1|210.1.1.2|J:1-198 000372528|e3gptX1|210.1.1.2|X:1-198 000372555|e3gpwJ1|210.1.1.2|J:1-198 000372556|e3gpwX1|210.1.1.2|X:1-198 000372767|e3hyeJ1|210.1.1.2|J:1-198 000372768|e3hyeX1|210.1.1.2|X:1-198 000393338|e3l5qO1|210.1.1.2|O:1-198 000393769|e1vsyY1|210.1.1.2|Y:1-198 000412855|e3nzjJ1|210.1.1.2|J:1-198 000412856|e3nzjX1|210.1.1.2|X:1-198 000412883|e3nzwJ1|210.1.1.2|J:1-198 000412884|e3nzwX1|210.1.1.2|X:1-198 000412911|e3nzxJ1|210.1.1.2|J:1-198 000412912|e3nzxX1|210.1.1.2|X:1-198 000417817|e3mg4J1|210.1.1.2|J:1-198 000417818|e3mg4X1|210.1.1.2|X:1-198 000419344|e3mg0J1|210.1.1.2|J:1-198 000419345|e3mg0X1|210.1.1.2|X:1-198 000419372|e3mg6J1|210.1.1.2|J:1-198 000419373|e3mg6X1|210.1.1.2|X:1-198 000419400|e3mg7J1|210.1.1.2|J:1-198 000419401|e3mg7X1|210.1.1.2|X:1-198 000419428|e3mg8J1|210.1.1.2|J:1-198 000419429|e3mg8X1|210.1.1.2|X:1-198 000421319|e3okjJ1|210.1.1.2|J:1-198 000421320|e3okjX1|210.1.1.2|X:1-198 000424416|e3oeuX1|210.1.1.2|X:1-198 000424443|e3oevJ1|210.1.1.2|J:1-198 000431046|e3tddJ1|210.1.1.2|J:1-198 000431047|e3tddX1|210.1.1.2|X:1-198 000435255|e3shjJ1|210.1.1.2|J:1-198 000435256|e3shjX1|210.1.1.2|X:1-198 000470434|e1fntK1|210.1.1.2|K:1-198 000470435|e1fntY1|210.1.1.2|Y:1-198 000969111|e4gk7X1|210.1.1.2|X:1-198 000969112|e4inrX1|210.1.1.2|X:1-198 000969113|e3sdkX1|210.1.1.2|X:1-198 000969114|e4intJ1|210.1.1.2|J:1-198 000969115|e3un4X1|210.1.1.2|X:1-198 000969116|e4inuX1|210.1.1.2|X:1-198 000969117|e4inuJ1|210.1.1.2|J:1-198 000969118|e3sdkJ1|210.1.1.2|J:1-198 000969119|e4fzgX1|210.1.1.2|X:1-198 000969120|e4g4sK1|210.1.1.2|K:1-198 000969121|e4fzgJ1|210.1.1.2|J:1-198 000969122|e3un8X1|210.1.1.2|X:1-198 000969123|e4fzcX1|210.1.1.2|X:1-198 000969124|e4intX1|210.1.1.2|X:1-198 000969125|e3sdiX1|210.1.1.2|X:1-198 000969126|e4j70X1|210.1.1.2|X:1-198 000969127|e3un8J1|210.1.1.2|J:1-198 001014634|e4jsqJ1|210.1.1.2|J:1-198 001014635|e4jsuJ1|210.1.1.2|J:1-198 001014636|e4jt0J1|210.1.1.2|J:1-198 001014638|e4jsqX1|210.1.1.2|X:1-198 001014639|e4jsuX1|210.1.1.2|X:1-198 001014640|e4jt0X1|210.1.1.2|X:1-198 001095283|e4c0v41|210.1.1.2|4:1-198 001125507|e4lqiJ1|210.1.1.2|J:1-198 001126096|e4lqiX1|210.1.1.2|X:1-198 001140765|e4hnpJ1|210.1.1.2|J:1-198 001142471|e4hnpX1|210.1.1.2|X:1-198 001142496|e4hrcJ1|210.1.1.2|J:1-198 001142497|e4hrcX1|210.1.1.2|X:1-198 001142524|e4hrdJ1|210.1.1.2|J:1-198 001142525|e4hrdX1|210.1.1.2|X:1-198 001142832|e3l5q11|210.1.1.2|1:1-198 001283897|e4cr241|210.1.1.2|4:1-198 001283929|e4cr341|210.1.1.2|4:1-198 001283954|e4cr441|210.1.1.2|4:1-198 001299662|e4ltcJ1|210.1.1.2|J:1-198 001299663|e4ltcX1|210.1.1.2|X:1-198 001317117|e4q1sJ1|210.1.1.2|J:1-198 001317118|e4q1sX1|210.1.1.2|X:1-198 001401619|e3wxrY1|210.1.1.2|Y:1-198 001438954|e4v7oAO1|210.1.1.2|AO:1-198 001438955|e4v7oA11|210.1.1.2|A1:1-198 001438956|e4v7oBK1|210.1.1.2|BK:1-198 001438957|e4v7oBY1|210.1.1.2|BY:1-198 001567993|e5a5b41|210.1.1.2|4:1-198 001842370|e3jco61|210.1.1.2|6:1-198 001842371|e3jcok1|210.1.1.2|k:1-198 001842433|e3jcp61|210.1.1.2|6:1-198 001842434|e3jcpk1|210.1.1.2|k:1-198 002047322|e5wvi41|210.1.1.2|4:1-198 002047323|e5wvig1|210.1.1.2|g:1-198 002047342|e5wvk41|210.1.1.2|4:1-198 002047343|e5wvkg1|210.1.1.2|g:1-198 cath|current|1fntK00/-1-197 cath|current|1fntY00/-1-197 cath|current|1g0uJ00/-1-193 cath|current|1g0uX00/-1-193 cath|current|1g65J00/-1-193 cath|current|1g65X00/-1-193 cath|current|1jd2J00/-1-193 cath|current|1jd2Q00/-1-193 cath|current|1rypK00/-1-197 cath|current|1rypY00/-1-197 cath|current|1vsyK00/401-4197 cath|current|1vsyY00/401-4197 cath|current|1z7qK00/1-198 cath|current|1z7qY00/1-198 cath|current|2f16J00/-1-193 cath|current|2f16X00/-1-193 cath|current|2fakJ00/-1-193 cath|current|2fakX00/-1-193 cath|current|2fnyJ00/-1-193 cath|current|2fnyX00/-1-193 cath|current|2gplJ00/-1-193 cath|current|2gplX00/-1-193 cath|current|2zcyJ00/-1-193 cath|current|2zcyX00/-1-193 cath|current|3bdmJ00/-1-193 cath|current|3bdmX00/-1-193 cath|current|3d29J00/-1-193 cath|current|3d29X00/-1-193 cath|current|3dy3J00/-1-193 cath|current|3dy3X00/-1-193 cath|current|3dy4J00/-1-193 cath|current|3dy4X00/-1-193 cath|current|3e47J00/-1-193 cath|current|3e47X00/-1-193 cath|current|3gpjJ00/-1-193 cath|current|3gpjX00/-1-193 cath|current|3gptJ00/-1-193 cath|current|3gptX00/-1-193 cath|current|3gpwJ00/-1-193 cath|current|3gpwX00/-1-193 cath|current|3hyeJ00/-1-193 cath|current|3hyeX00/-1-193 cath|current|3l5q100/401-4197 cath|current|3l5qO00/401-4197 cath|current|3mg0J00/-1-193 cath|current|3mg0X00/-1-193 cath|current|3mg4J00/-1-193 cath|current|3mg4X00/-1-193 cath|current|3mg6J00/-1-193 cath|current|3mg6X00/-1-193 cath|current|3mg7J00/-1-193 cath|current|3mg7X00/-1-193 cath|current|3mg8J00/-1-193 cath|current|3mg8X00/-1-193 cath|current|3nzjJ00/-1-193 cath|current|3nzjX00/-1-193 cath|current|3nzwJ00/-1-193 cath|current|3nzwX00/-1-193 cath|current|3nzxJ00/-1-193 cath|current|3nzxX00/-1-193 cath|current|3oeuJ00/-1-193 cath|current|3oeuX00/-1-193 cath|current|3oevJ00/-1-193 cath|current|3oevX00/1-193 cath|current|3okjJ00/-1-193 cath|current|3okjX00/-1-193 cath|current|3sdiJ00/-1-193 cath|current|3sdiX00/-1-193 cath|current|3sdkJ00/-1-193 cath|current|3sdkX00/-1-193 cath|current|3shjJ00/-1-193 cath|current|3shjX00/-1-193 cath|current|3tddJ00/-1-193 cath|current|3tddX00/-1-193 cath|current|3un4J00/1-198 cath|current|3un4X00/1-198 cath|current|3un8J00/1-198 cath|current|3un8X00/1-198 cath|current|3wxrK00/1-197 cath|current|3wxrY00/0-197 cath|current|4eu2K00/-1-195 cath|current|4eu2Y00/-1-195 cath|current|4fzcJ00/1-198 cath|current|4fzcX00/1-198 cath|current|4fzgJ00/1-198 cath|current|4fzgX00/1-198 cath|current|4g4sK00/0-194 cath|current|4gk7J00/-1-196 cath|current|4gk7X00/-1-196 cath|current|4hnpJ00/1-198 cath|current|4hnpX00/1-198 cath|current|4hrcJ00/1-198 cath|current|4hrcX00/1-198 cath|current|4hrdJ00/1-198 cath|current|4hrdX00/1-198 cath|current|4inrJ00/1-198 cath|current|4inrX00/1-198 cath|current|4intJ00/1-198 cath|current|4intX00/1-198 cath|current|4inuJ00/1-198 cath|current|4inuX00/1-198 cath|current|4j70J00/1-198 cath|current|4j70X00/1-198 cath|current|4jsqJ00/1-198 cath|current|4jsqX00/1-198 cath|current|4jsuJ00/1-198 cath|current|4jsuX00/1-198 cath|current|4jt0J00/1-198 cath|current|4jt0X00/1-198 cath|current|4lqiJ00/-1-193 cath|current|4lqiX00/-1-193 cath|current|4ltcJ00/1-198 cath|current|4ltcX00/1-198 cath|current|4nnnJ00/1-195 cath|current|4nnnX00/1-195 cath|current|4nnwJ00/1-195 cath|current|4nnwX00/1-195 cath|current|4no1J00/1-195 cath|current|4no1X00/1-195 cath|current|4no6J00/1-195 cath|current|4no6X00/1-195 cath|current|4no8J00/1-195 cath|current|4no8X00/1-195 cath|current|4no9J00/1-195 cath|current|4no9X00/1-195 cath|current|4q1sJ00/1-198 cath|current|4q1sX00/1-198 cath|current|4qbyJ00/1-195 cath|current|4qbyX00/1-195 cath|current|4qlqJ00/1-195 cath|current|4qlqX00/1-195 cath|current|4qlsJ00/1-195 cath|current|4qlsX00/1-195 cath|current|4qltJ00/1-195 cath|current|4qltX00/1-195 cath|current|4qluJ00/1-195 cath|current|4qluX00/1-195 cath|current|4qlvJ00/1-195 cath|current|4qlvX00/1-195 cath|current|4r02J00/1-195 cath|current|4r02X00/1-195 cath|current|4r17J00/1-195 cath|current|4r17X00/1-195 cath|current|4r18J00/1-195 cath|current|4r18X00/1-195 cath|current|4rurJ00/1-195 cath|current|4rurX00/1-195 d1g0uj_ d1g0ux_ d1g65j_ d1g65x_ d1jd2j_ d1jd2q_ d1rypk_ d1rypy_ d1vsyk_ d1vsyy_ d2f16j_ d2f16x_ d2fakj_ d2fakx_ d2fnyj_ d2fnyx_ d2gplj_ d2gplx_ d2zcyj_ d2zcyx_ d3bdmj_ d3bdmx_ d3d29j_ d3d29x_ d3dy3j_ d3dy3x_ d3dy4j_ d3dy4x_ d3e47j_ d3e47x_ d3gpjj_ d3gpjx_ d3gptj_ d3gptx_ d3gpwj_ d3gpwx_ d3hyej_ d3hyex_ d3l5q1_ d3l5qo_ d3mg0j_ d3mg0x_ d3mg4j_ d3mg4x_ d3mg6j_ d3mg6x_ d3mg7j_ d3mg7x_ d3mg8j_ d3mg8x_ d3nzjj_ d3nzjx_ d3nzwj_ d3nzwx_ d3nzxj_ d3nzxx_ d3oeuj_ d3oeux_ d3oevj_ d3okjj_ d3okjx_ d3sdij_ d3sdix_ d3sdkj_ d3sdkx_ d3shjj_ d3shjx_ d3tddj_ d3tddx_ d3un8j_ d3un8x_ d3wxry_ d4fzcj_ d4fzcx_ d4fzgj_ d4fzgx_ d4hnpj_ d4hnpx_ d4hrcj_ d4hrcx_ d4hrdj_ d4hrdx_ d4inrj_ d4inrx_ d4intj_ d4intx_ d4inuj_ d4inux_ d4j70j_ d4j70x_ d4jsqj_ d4jsqx_ d4jsuj_ d4jsux_ d4jt0j_ d4jt0x_ d4lqij_ d4lqix_ d4ltcj_ d4ltcx_ d4q1sj_ d4q1sx_ YER012W YER012W YER012W YER012W YER012W YER012W YER012W 1rypK YER012W NP_010928.1 YER012w___KOG0177 YER012W YER012W 4932.YER012W YER012W 1fnt.K 1fnt.Y 1g0u.J 1g0u.X 1g65.J 1g65.X 1jd2.J 1jd2.Q 1ryp.K 1ryp.Y 1z7q.K 1z7q.Y 2f16.J 2f16.X 2fak.J 2fak.X 2gpl.J 2gpl.X 2zcy.J 2zcy.X 3bdm.J 3bdm.X 3d29.J 3d29.X 3dy3.J 3dy3.X 3dy4.J 3dy4.X 3e47.J 3e47.X 3gpj.J 3gpj.X 3gpt.J 3gpt.X 3gpw.J 3gpw.X 3hye.J 3hye.X 3jco.6 3jco.k 3jcp.6 3jcp.k 3mg0.J 3mg0.X 3mg4.J 3mg4.X 3mg6.J 3mg6.X 3mg7.J 3mg7.X 3mg8.J 3mg8.X 3nzj.J 3nzj.X 3nzw.J 3nzw.X 3nzx.J 3nzx.X 3oeu.J 3oeu.X 3oev.J 3oev.X 3okj.J 3okj.X 3sdi.J 3sdi.X 3sdk.J 3sdk.X 3shj.J 3shj.X 3tdd.J 3tdd.X 3un4.J 3un4.X 3un8.J 3un8.X 4cr2.4 4cr3.4 4cr4.4 4eu2.K 4eu2.Y 4fzc.J 4fzc.X 4fzg.J 4fzg.X 4g4s.K 4gk7.J 4gk7.X 4hnp.J 4hnp.X 4hrc.J 4hrc.X 4hrd.J 4hrd.X 4inr.J 4inr.X 4int.J 4int.X 4inu.J 4inu.X 4j70.J 4j70.X 4jsq.J 4jsq.X 4jsu.J 4jsu.X 4jt0.J 4jt0.X 4lqi.J 4lqi.X 4ltc.J 4ltc.X 4nnn.J 4nnn.X 4nnw.J 4nnw.X 4no1.J 4no1.X 4no6.J 4no6.X 4no8.J 4no8.X 4no9.J 4no9.X 4q1s.J 4q1s.X 4qby.J 4qby.X 4qlq.J 4qlq.X 4qls.J 4qls.X 4qlt.J 4qlt.X 4qlu.J 4qlu.X 4qlv.J 4qlv.X 4qux.J 4qux.X 4quy.J 4quy.X 4qv0.J 4qv0.X 4qv1.J 4qv1.X 4qv3.J 4qv3.X 4qv4.J 4qv4.X 4qv5.J 4qv5.X 4qv6.J 4qv6.X 4qv7.J 4qv7.X 4qv8.J 4qv8.X 4qv9.J 4qv9.X 4qvl.J 4qvl.X 4qvm.J 4qvm.X 4qvn.J 4qvn.X 4qvp.J 4qvp.X 4qvq.J 4qvq.X 4qvv.J 4qvv.X 4qvw.J 4qvw.X 4qvy.J 4qvy.X 4qw0.J 4qw0.X 4qw1.J 4qw1.X 4qw3.J 4qw3.X 4qw4.J 4qw4.X 4qw5.J 4qw5.X 4qw6.J 4qw6.X 4qw7.J 4qw7.X 4qwf.J 4qwf.X 4qwg.J 4qwg.X 4qwi.J 4qwi.X 4qwj.J 4qwj.X 4qwk.J 4qwk.X 4qwl.J 4qwl.X 4qwr.J 4qwr.X 4qws.J 4qws.X 4qwu.J 4qwu.X 4qwx.J 4qwx.X 4qxj.J 4qxj.X 4qz0.J 4qz0.X 4qz1.J 4qz1.X 4qz2.J 4qz2.X 4qz3.J 4qz3.X 4qz4.J 4qz4.X 4qz5.J 4qz5.X 4qz6.J 4qz6.X 4qz7.J 4qz7.X 4qzw.J 4qzw.X 4qzx.J 4qzx.X 4qzz.J 4qzz.X 4r00.J 4r00.X 4r02.J 4r02.X 4r17.J 4r17.X 4r18.J 4r18.X 4rur.J 4rur.X 4v7o.A1 4v7o.AO 4v7o.BK 4v7o.BY 4x6z.K 4x6z.Y 4y69.J 4y69.X 4y6a.J 4y6a.X 4y6v.J 4y6v.X 4y6z.J 4y6z.X 4y70.J 4y70.X 4y74.J 4y74.X 4y75.J 4y75.X 4y77.J 4y77.X 4y78.J 4y78.X 4y7w.J 4y7w.X 4y7x.J 4y7x.X 4y7y.J 4y7y.X 4y80.J 4y80.X 4y81.J 4y81.X 4y82.J 4y82.X 4y84.J 4y84.X 4y8g.J 4y8g.X 4y8h.J 4y8h.X 4y8i.J 4y8i.X 4y8j.J 4y8j.X 4y8k.J 4y8k.X 4y8l.J 4y8l.X 4y8m.J 4y8m.X 4y8n.J 4y8n.X 4y8o.J 4y8o.X 4y8p.J 4y8p.X 4y8q.J 4y8q.X 4y8r.J 4y8r.X 4y8s.J 4y8s.X 4y8t.J 4y8t.X 4y8u.J 4y8u.X 4y9y.J 4y9y.X 4y9z.J 4y9z.X 4ya0.J 4ya0.X 4ya1.J 4ya1.X 4ya2.J 4ya2.X 4ya3.J 4ya3.X 4ya4.J 4ya4.X 4ya5.J 4ya5.X 4ya7.J 4ya7.X 4ya9.J 4ya9.X 4z1l.J 4z1l.X 4zzg.K 4zzg.Y 5a5b.4 5ahj.J 5ahj.X 5bou.J 5bou.X 5bxl.J 5bxl.X 5bxn.J 5bxn.X 5cgf.J 5cgf.X 5cgg.J 5cgg.X 5cgh.J 5cgh.X 5cgi.J 5cgi.X 5cz4.J 5cz4.X 5cz5.J 5cz5.X 5cz6.J 5cz6.X 5cz7.J 5cz7.X 5cz8.J 5cz8.X 5cz9.J 5cz9.X 5cza.J 5cza.X 5d0s.J 5d0s.X 5d0t.J 5d0t.X 5d0v.J 5d0v.X 5d0w.J 5d0w.X 5d0x.J 5d0x.X 5d0z.J 5d0z.X 5dki.J 5dki.X 5dkj.J 5dkj.X 5fg7.J 5fg7.X 5fg9.J 5fg9.X 5fga.J 5fga.X 5fgd.J 5fgd.X 5fge.J 5fge.X 5fgf.J 5fgf.X 5fgg.J 5fgg.X 5fgh.J 5fgh.X 5fgi.J 5fgi.X 5fhs.J 5fhs.X 5jhr.J 5jhr.X 5jhs.J 5jhs.X 5l52.J 5l52.X 5l54.J 5l54.X 5l55.J 5l55.X 5l5a.J 5l5a.X 5l5b.J 5l5b.X 5l5d.J 5l5d.X 5l5e.J 5l5e.X 5l5f.J 5l5f.X 5l5h.J 5l5h.X 5l5i.J 5l5i.X 5l5j.J 5l5j.X 5l5o.J 5l5o.X 5l5p.J 5l5p.X 5l5q.J 5l5q.X 5l5r.J 5l5r.X 5l5s.J 5l5s.X 5l5t.J 5l5t.X 5l5u.J 5l5u.X 5l5v.J 5l5v.X 5l5w.J 5l5w.X 5l5x.J 5l5x.X 5l5y.J 5l5y.X 5l5z.J 5l5z.X 5l60.J 5l60.X 5l61.J 5l61.X 5l62.J 5l62.X 5l63.J 5l63.X 5l64.J 5l64.X 5l65.J 5l65.X 5l66.J 5l66.X 5l67.J 5l67.X 5l68.J 5l68.X 5l69.J 5l69.X 5l6a.J 5l6a.X 5l6b.J 5l6b.X 5l6c.J 5l6c.X 5lai.J 5lai.X 5laj.J 5laj.X 5ltt.J 5ltt.X 5m2b.J 5m2b.X 5mp9.4 5mp9.k 5mpa.4 5mpa.k 5mpb.4 5mpb.k 5mpc.4 5mpc.k 5wvi.4 5wvi.g 5wvk.4 5wvk.g YER012W YER012W YER012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]