SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER012W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER012W
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.92e-52
Family Proteasome subunits 0.00000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
side of membrane 1.701 22.27
external side of plasma membrane 1.827 22.27
cytosol 1.301 13.15
ribonucleoprotein complex 1.414 8.37
cytoplasmic ribonucleoprotein granule 1.98 8.37
extracellular organelle 1.606 4.81

Protein sequence

External link(s) Locus: YER012W   Protein: S000000814
Sequence length 198
Comment PRE1 SGDID:S000000814, Chr V from 177834-178430, Verified ORF, "Beta 4 subunit of the 20S proteasome; localizes to the nucleus throughout the cell cycle"
Sequence
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI
QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID
YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVI
VKIVDKDGIRQVDDFQAQ
Download sequence
Identical sequences B3LS24 B5VHE3 C7GKJ0 C8Z712 E7KBN2 E7KMK1 E7LTQ2 E7NGZ9 E7QDS7 G2WCP3 H0GEZ9 N1PA82 P22141 W7Q4R5 W7QZD7
YER012W YER012W YER012W SCRT_04480 YER012W YER012W YER012W YER012W YER012W YER012W YER012W YER012W 4932.YER012W YER012W YER012W YER012W 1fnt.K 1fnt.Y 1g0u.J 1g0u.X 1g65.J 1g65.X 1jd2.J 1jd2.Q 1ryp.K 1ryp.Y 1vsy.K 1vsy.Y 1z7q.K 1z7q.Y 2f16.J 2f16.X 2fak.J 2fak.X 2fny.J 2fny.X 2gpl.J 2gpl.X 2zcy.J 2zcy.X 3bdm.J 3bdm.X 3d29.J 3d29.X 3dy3.J 3dy3.X 3dy4.J 3dy4.X 3e47.J 3e47.X 3gpj.J 3gpj.X 3gpt.J 3gpt.X 3gpw.J 3gpw.X 3hye.J 3hye.X 3l5q.1 3l5q.O 3mg0.J 3mg0.X 3mg4.J 3mg4.X 3mg6.J 3mg6.X 3mg7.J 3mg7.X 3mg8.J 3mg8.X 3nzj.J 3nzj.X 3nzw.J 3nzw.X 3nzx.J 3nzx.X 3oeu.J 3oeu.X 3oev.J 3oev.X 3okj.J 3okj.X 3sdi.J 3sdi.X 3sdk.J 3sdk.X 3shj.J 3shj.X 3tdd.J 3tdd.X 3un4.J 3un4.X 3un8.J 3un8.X 4b4t.4 4bgr.4 4c0v.4 4cr2.4 4cr3.4 4cr4.4 4eu2.K 4eu2.Y 4fzc.J 4fzc.X 4fzg.J 4fzg.X 4g4s.K 4gk7.J 4gk7.X 4hnp.J 4hnp.X 4hrc.J 4hrc.X 4hrd.J 4hrd.X 4inr.J 4inr.X 4int.J 4int.X 4inu.J 4inu.X 4j70.J 4j70.X 4jsq.J 4jsq.X 4jsu.J 4jsu.X 4jt0.J 4jt0.X 4lqi.J 4lqi.X 4ltc.J 4ltc.X 4nnn.J 4nnn.X 4nnw.J 4nnw.X 4no1.J 4no1.X 4no6.J 4no6.X 4no8.J 4no8.X 4no9.J 4no9.X 4q1s.J 4q1s.X 4qby.J 4qby.X 4qlq.J 4qlq.X 4qls.J 4qls.X 4qlt.J 4qlt.X 4qlu.J 4qlu.X 4qlv.J 4qlv.X 4r02.J 4r02.X 1rypK YER012w___KOG0177 YER012W YER012W YER012W YER012W YER012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]