SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER020W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER020W
Domain Number 1 Region: 120-147,269-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-53
Family G proteins 6.37e-06
Further Details:      
 
Domain Number 2 Region: 151-273
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.67e-29
Family Transducin (alpha subunit), insertion domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.69
centrosome 1.806 21.22
chromosomal part 1.477 20.41
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36
ribonucleoprotein complex 1.418 9.43

Protein sequence

External link(s) Locus: YER020W   Protein: S000000822
Sequence length 449
Comment GPA2 SGDID:S000000822, Chr V from 195167-196516, Verified ORF, "Nucleotide binding alpha subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p, has signaling role in response to nutrients; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery"
Sequence
MGLCASSEKNGSTPDTQTASAGSDNVGKAKVPPKQEPQKTVRTVNTANQQEKQQQRQQQP
SPHNVKDRKEQNGSINNAISPTATANTSGSQQINIDSALRDRSSNVAAQPSLSDASSGSN
DKELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTR
FNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASK
FYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQ
RSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSV
VLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLNRANLSIYPHVTQA
TDTSNIRLVFAAIKETILENTLKDSGVLQ
Download sequence
Identical sequences P10823
YER020W 4932.YER020W YER020W YER020W YER020W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]