SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER020W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER020W
Domain Number 1 Region: 120-147,269-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-53
Family G proteins 6.37e-06
Further Details:      
 
Domain Number 2 Region: 151-273
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.67e-29
Family Transducin (alpha subunit), insertion domain 0.00051
Further Details:      
 

Protein sequence

External link(s) Locus: YER020W   Protein: S000000822
Sequence length 449
Comment GPA2 SGDID:S000000822, Chr V from 195167-196516, Verified ORF, "Nucleotide binding alpha subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p, has signaling role in response to nutrients; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery"
Sequence
MGLCASSEKNGSTPDTQTASAGSDNVGKAKVPPKQEPQKTVRTVNTANQQEKQQQRQQQP
SPHNVKDRKEQNGSINNAISPTATANTSGSQQINIDSALRDRSSNVAAQPSLSDASSGSN
DKELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTR
FNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASK
FYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQ
RSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSV
VLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLNRANLSIYPHVTQA
TDTSNIRLVFAAIKETILENTLKDSGVLQ
Download sequence
Identical sequences P10823
YER020W 4932.YER020W YER020W YER020W YER020W

Jump to [ Top of page · Domain architecture · Domain assignment details ]