SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER020W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER020W
Domain Number 1 Region: 120-147,269-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-53
Family G proteins 0.00000637
Further Details:      
 
Domain Number 2 Region: 151-273
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.67e-29
Family Transducin (alpha subunit), insertion domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Locus: YER020W   Protein: S000000822
Sequence length 449
Comment GPA2 SGDID:S000000822, Chr V from 195167-196516, Verified ORF, "Nucleotide binding alpha subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p, has signaling role in response to nutrients; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery"
Sequence
MGLCASSEKNGSTPDTQTASAGSDNVGKAKVPPKQEPQKTVRTVNTANQQEKQQQRQQQP
SPHNVKDRKEQNGSINNAISPTATANTSGSQQINIDSALRDRSSNVAAQPSLSDASSGSN
DKELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTR
FNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASK
FYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQ
RSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSV
VLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLNRANLSIYPHVTQA
TDTSNIRLVFAAIKETILENTLKDSGVLQ
Download sequence
Identical sequences P10823
YER020W 4932.YER020W YER020W YER020W YER020W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]