SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER023C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER023C-A   Protein: S000028622
Sequence length 70
Comment YER023C-A SGDID:S000028622, Chr V from 201733-201521, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps verified gene PRO3; identified by gene-trapping, microarray expression analysis, and genome-wide homology searching"
Sequence
MAHSLLSCNGIPNFNPLSIKDSNIKRTKAGPEPTKAVAASMFFSGSSTYLPTWLINSLTS
GFCSLETSAE
Download sequence
Identical sequences C8Z725 Q8TGP2
YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A 4932.YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]