SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER023C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YER023C-A   Protein: S000028622
Sequence length 70
Comment YER023C-A SGDID:S000028622, Chr V from 201733-201521, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps verified gene PRO3; identified by gene-trapping, microarray expression analysis, and genome-wide homology searching"
Sequence
MAHSLLSCNGIPNFNPLSIKDSNIKRTKAGPEPTKAVAASMFFSGSSTYLPTWLINSLTS
GFCSLETSAE
Download sequence
Identical sequences C8Z725 Q8TGP2
YER023C-A YER023C-A YER023C-A 4932.YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A YER023C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]