SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER044C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER044C-A   Protein: S000001954
Sequence length 408
Comment MEI4 SGDID:S000001954, Chr V from 239773-239711,239622-238459, reverse complement, Verified ORF, "Meiosis-specific protein involved in recombination; required for chromosome synapsis; required for production of viable spores"
Sequence
MSRGKLEDMEQKETSEVDWIICFALIQSRNPTLWKRALSRKKGDVEDVGALKSEKNLKIN
PRENSKHIYKWVAPFENGFLNNKSLFAHLEPIYNFLCQNKYKSFEDAVGLKELQSFSKDV
STADINNWFLPRYKILLKILSLKTKEIDFRGLSQVFQTLQILLVSHYSHRIDSDSSFKRT
LIDVHVFNFIAKFLFNRILLKKNQNDPKWLQNFYDQGDGKHLCDKVDYKRLCSLHFTLIY
SIINIQLIKIKTNQTFEPQILKYVSVLKLIEHILIIIESLIHVLIRFVSKHKLICINRKK
AYCRVYLERELSLKKTYLKNFYSVISGVPEKELGGLLKILKIVILSLLETFESIEWQHLK
PFLEKFPAHEISLQKKRKYIQAALLITAERNLIARFRLSRWFNETENI
Download sequence
Identical sequences P29467
YER044C-A YER044C-A YER044C-A 4932.YER044C-A YER044C-A YER044C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]