SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER044C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YER044C-A   Protein: S000001954
Sequence length 408
Comment MEI4 SGDID:S000001954, Chr V from 239773-239711,239622-238459, reverse complement, Verified ORF, "Meiosis-specific protein involved in recombination; required for chromosome synapsis; required for production of viable spores"
Sequence
MSRGKLEDMEQKETSEVDWIICFALIQSRNPTLWKRALSRKKGDVEDVGALKSEKNLKIN
PRENSKHIYKWVAPFENGFLNNKSLFAHLEPIYNFLCQNKYKSFEDAVGLKELQSFSKDV
STADINNWFLPRYKILLKILSLKTKEIDFRGLSQVFQTLQILLVSHYSHRIDSDSSFKRT
LIDVHVFNFIAKFLFNRILLKKNQNDPKWLQNFYDQGDGKHLCDKVDYKRLCSLHFTLIY
SIINIQLIKIKTNQTFEPQILKYVSVLKLIEHILIIIESLIHVLIRFVSKHKLICINRKK
AYCRVYLERELSLKKTYLKNFYSVISGVPEKELGGLLKILKIVILSLLETFESIEWQHLK
PFLEKFPAHEISLQKKRKYIQAALLITAERNLIARFRLSRWFNETENI
Download sequence
Identical sequences P29467
YER044C-A YER044C-A YER044C-A YER044C-A 4932.YER044C-A YER044C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]