SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER046W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YER046W-A   Protein: S000028747
Sequence length 109
Comment YER046W-A SGDID:S000028747, Chr V from 243699-244028, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MQNIFYRSAYVHTVCPARLEYYLLLPLLLYYYYYYHHHEPDDPNCEAHFSYFTNPSWDTE
GLIYTKLFLKSTRPMGLIISLSVSNNLSPRSRSGPMAASFAKDVISLPE
Download sequence
Identical sequences YER046W-A YER046W-A YER046W-A 4932.YER046W-A YER046W-A YER046W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]