SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER046W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER046W-A   Protein: S000028747
Sequence length 109
Comment YER046W-A SGDID:S000028747, Chr V from 243699-244028, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MQNIFYRSAYVHTVCPARLEYYLLLPLLLYYYYYYHHHEPDDPNCEAHFSYFTNPSWDTE
GLIYTKLFLKSTRPMGLIISLSVSNNLSPRSRSGPMAASFAKDVISLPE
Download sequence
Identical sequences YER046W-A YER046W-A YER046W-A 4932.YER046W-A YER046W-A YER046W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]