SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER059W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER059W   Protein: S000000861
Sequence length 420
Comment PCL6 SGDID:S000000861, Chr V from 272622-273884, Verified ORF, "Pho85p cyclin of the Pho80p subfamily; forms the major Glc8p kinase together with Pcl7p and Pho85p; involved in the control of glycogen storage by Pho85p; stabilized by Elongin C binding"
Sequence
MSIKGDSPSSTNASSSPKSTYSIQSDDKANLGSGNVDIRTDNSQQDSNNRRDIVVVTRVA
SEETLESQSSTSSMGIRPESSFNYEDASNQARVEMNNRVHGSNMNTINKYYPVRFPKNNE
RQLSDTNNLNEKVQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALL
TKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRI
QKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSA
CNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNS
RYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADLLYRFWNNAKAQSQALVTGM
Download sequence
Identical sequences B5VHJ0 C7GWI8 C8Z765 E7KBR9 E7QDW4 H0GF45 P40038
YER059W YER059W 4932.YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W

Jump to [ Top of page · Domain architecture · Domain assignment details ]