SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER059W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YER059W   Protein: S000000861
Sequence length 420
Comment PCL6 SGDID:S000000861, Chr V from 272622-273884, Verified ORF, "Pho85p cyclin of the Pho80p subfamily; forms the major Glc8p kinase together with Pcl7p and Pho85p; involved in the control of glycogen storage by Pho85p; stabilized by Elongin C binding"
Sequence
MSIKGDSPSSTNASSSPKSTYSIQSDDKANLGSGNVDIRTDNSQQDSNNRRDIVVVTRVA
SEETLESQSSTSSMGIRPESSFNYEDASNQARVEMNNRVHGSNMNTINKYYPVRFPKNNE
RQLSDTNNLNEKVQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALL
TKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRI
QKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSA
CNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNS
RYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADLLYRFWNNAKAQSQALVTGM
Download sequence
Identical sequences B5VHJ0 C7GWI8 C8Z765 E7KBR9 E7QDW4 H0GF45 P40038 W7QZH3
YER059W YER059W 4932.YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W YER059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]