SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER067C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YER067C-A   Protein: S000028748
Sequence length 107
Comment YER067C-A SGDID:S000028748, Chr V from 292561-292238, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the uncharacterized ORF YER067W"
Sequence
MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFIKCLFLRFFVK
FKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFFRVLVRLV
Download sequence
Identical sequences C8Z774 W7PUN6
YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A 4932.YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]