SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER067C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER067C-A   Protein: S000028748
Sequence length 107
Comment YER067C-A SGDID:S000028748, Chr V from 292561-292238, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the uncharacterized ORF YER067W"
Sequence
MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFIKCLFLRFFVK
FKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFFRVLVRLV
Download sequence
Identical sequences C8Z774
YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A 4932.YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A YER067C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]