SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER070W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER070W
Domain Number 1 Region: 215-646,679-755
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.27e-193
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000314
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.44e-70
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transferase activity, transferring acyl groups 1.683 93.6
acetyltransferase activity 1.984 6.72
Biological Process IC (bits) H-Score
nucleoside phosphate biosynthetic process 1.584 54.66
carbohydrate derivative biosynthetic process 1.386 35.24
DNA replication 1.891 8.13
protein oligomerization 1.532 5.82
Cellular Component IC (bits) H-Score
oxidoreductase complex 1.872 30.43

Protein sequence

External link(s) Locus: YER070W   Protein: S000000872
Sequence length 888
Comment RNR1 SGDID:S000000872, Chr V from 298948-301614, Verified ORF, "One of two large regulatory subunits of ribonucleotide-diphosphate reductase; the RNR complex catalyzes rate-limiting step in dNTP synthesis, regulated by DNA replication and DNA damage checkpoint pathways via localization of small subunits"
Sequence
MYVYKRDGRKEPVQFDKITARISRLCYGLDPKHIDAVKVTQRIISGVYEGVTTIELDNLA
AETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVVEDLYRYVNAATGKPAPMISDDV
YNIVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQVAERPQHLIMRVALGIHG
RDIEAALETYNLMSLKYFTHASPTLFNAGTPKPQMSSCFLVAMKEDSIEGIYDTLKECAL
ISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALY
LEPWHADIFDFIDIRKNHGKEEIRARDLFPALWIPDLFMKRVEENGTWTLFSPTSAPGLS
DCYGDEFEALYTRYEKEGRGKTIKAQKLWYSILEAQTETGTPFVVYKDACNRKSNQKNLG
VIKSSNLCCEIVEYSAPDETAVCNLASVALPAFIETSEDGKTSTYNFKKLHEIAKVVTRN
LNRVIDRNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQIFETIY
HASMEASCELAQKDGPYETFQGSPASQGILQFDMWDQKPYGMWDWDTLRKDIMKHGVRNS
LTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSGEFQVVNPYLLRDLVDLGIWDEGMK
QYLITQNGSIQGLPNVPQELKDLYKTVWEISQKTIINMAADRSVYIDQSHSLNLFLRAPT
MGKLTSMHFYGWKKGLKTGMYYLRTQAASAAIQFTIDQKIADQATENVADISNLKRPSYM
PSSASYAASDFVPAAVTANATIPSLDSSSEASREASPAPTGSHSLTKGMAELNVQESKVE
VPEVPAPTKNEEKAAPIVDDEETEFDIYNSKVIACAIDNPEACEMCSG
Download sequence
Identical sequences C7GRQ2 P21524
YER070W YER070W YER070W YER070W YER070W YER070W YER070W 4932.YER070W 1zyz.A 1zyz.B 1zzd.A 2cvs.A 2cvt.A 2cvu.A 2cvv.A 2cvw.A 2cvx.A 2cvy.A 2eud.A 2zlf.A 2zlg.A 3k8t.A 3paw.A 3paw.B 3paw.C 3paw.D 3rsr.A 3s87.A 3s8b.A YER070w___KOG1112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]