SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER081W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER081W
Domain Number 1 Region: 155-350
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.09e-54
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000038
Further Details:      
 
Domain Number 2 Region: 57-176
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 5.1e-45
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.0000432
Further Details:      
 
Domain Number 3 Region: 396-468
Classification Level Classification E-value
Superfamily ACT-like 0.000000000105
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.369 13.53
microbody 1.856 13.02
side of membrane 1.633 12.26
organelle envelope 1.405 12.26
oxidoreductase complex 1.828 7.82
chloroplast stroma 2.009 6.88
Golgi membrane 1.639 6.7
cytosol 1.295 6.49
endoplasmic reticulum subcompartment 1.59 5.61
nuclear outer membrane-endoplasmic reticulum membrane network 1.527 5.61

Protein sequence

External link(s) Locus: YER081W   Protein: S000000883
Sequence length 469
Comment SER3 SGDID:S000000883, Chr V from 322682-324091, Verified ORF, "3-phosphoglycerate dehydrogenase, catalyzes the first step in serine and glycine biosynthesis; isozyme of Ser33p"
Sequence
MTSIDINNLQNTFQQAMNMSGSPGAVCTSPTQSFMNTVPQRLNAVKHPKILKPFSTGDMK
ILLLENVNQTAITIFEEQGYQVEFYKSSLPEEELIEKIKDVHAIGIRSKTRLTSNVLQHA
KNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLGDRSIE
LHTGTWNKVAARCWEVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTARQ
VSTLDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAV
KANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSIG
IEVATALSKYINEGNSVGSVNFPEVALKSLSYDQENTVRVLYIHQNVPGVLKTVNDILSN
HNIEKQFSDSNGEIAYLMADISSVDQSDIKDIYEQLNQTSAKISIRLLY
Download sequence
Identical sequences A0A0L8VRN8 A6ZR37 B3LRJ9 C7GRR4 C8Z793 E7KBU0 E7KMP8 E7NGU2 E7Q2Y3 G2WCX2 N1P4Y2 P40054
YER081W YER081W YER081W YER081W YER081W YER081W YER081W YER081W 4932.YER081W YER081W YER081W YER081W YER081W YER081W SCRT_04559 YER081W tr|A6ZR37|A6ZR37_YEAS7 YER081W YER081W YER081W YER081W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]