SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER082C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER082C
Domain Number 1 Region: 109-342
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-35
Family WD40-repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  YER082C
Domain Number - Region: 33-139
Classification Level Classification E-value
Superfamily 39 kda initiator binding protein, IBP39, C-terminal domains 0.00811
Family 39 kda initiator binding protein, IBP39, C-terminal domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YER082C   Protein: S000000884
Sequence length 554
Comment UTP7 SGDID:S000000884, Chr V from 325932-324268, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MGHKKNGHRRQIKERENQNKFERSTYTNNAKNNHTQTKDKKLRAGLKKIDEQYKKAVSSA
AATDYLLPESNGYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAK
NGTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQKKYTFIYDHE
GTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVSTGQLVSELRTKAGPTMAMAQ
NPWNAVMHLGHSNGTVSLWSPSMPEPLVKLLSARGPVNSIAIDRSGYYMATTGADRSMKI
WDIRNFKQLHSVESLPTPGTNVSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGG
NPHRNTPYMSHLFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFE
TKKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTMDANNKAKTN
SDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQKQLDKEKNIRKRNHQIKQGLISE
DHKDVIEEALSRFG
Download sequence
Identical sequences B3LRK0 B5VHL0 C7GRR5 C8Z794 G2WCX3 H0GF65 N1P3G1 P40055 W7Q4X3 W7RFZ9
4932.YER082C SCRT_04560 YER082C YER082C YER082C YER082C YER082C YER082C YER082C YER082C YER082C YER082C 355302 YER082C YER082C YER082C YER082c___KOG1272 YER082C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]