SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER082C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER082C
Domain Number 1 Region: 109-342
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-35
Family WD40-repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  YER082C
Domain Number - Region: 33-139
Classification Level Classification E-value
Superfamily 39 kda initiator binding protein, IBP39, C-terminal domains 0.00811
Family 39 kda initiator binding protein, IBP39, C-terminal domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
endosome 1.351 9.77
cytoplasmic vesicle part 1.417 9.77
endosome membrane 1.934 9.77
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67

Protein sequence

External link(s) Locus: YER082C   Protein: S000000884
Sequence length 554
Comment UTP7 SGDID:S000000884, Chr V from 325932-324268, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MGHKKNGHRRQIKERENQNKFERSTYTNNAKNNHTQTKDKKLRAGLKKIDEQYKKAVSSA
AATDYLLPESNGYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAK
NGTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQKKYTFIYDHE
GTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVSTGQLVSELRTKAGPTMAMAQ
NPWNAVMHLGHSNGTVSLWSPSMPEPLVKLLSARGPVNSIAIDRSGYYMATTGADRSMKI
WDIRNFKQLHSVESLPTPGTNVSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGG
NPHRNTPYMSHLFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFE
TKKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTMDANNKAKTN
SDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQKQLDKEKNIRKRNHQIKQGLISE
DHKDVIEEALSRFG
Download sequence
Identical sequences A0A0L8VRN0 B3LRK0 B5VHL0 C7GRR5 C8Z794 G2WCX3 H0GF65 N1P3G1 P40055
YER082C YER082C SCRT_04560 YER082C YER082C YER082C YER082C 355302 YER082C YER082C YER082C 4932.YER082C YER082C YER082C YER082C YER082c___KOG1272 YER082C YER082C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]