SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER082C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER082C
Domain Number 1 Region: 109-342
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-35
Family WD40-repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  YER082C
Domain Number - Region: 33-139
Classification Level Classification E-value
Superfamily 39 kda initiator binding protein, IBP39, C-terminal domains 0.00811
Family 39 kda initiator binding protein, IBP39, C-terminal domains 0.0032
Further Details:      
 

Protein sequence

External link(s) Locus: YER082C   Protein: S000000884
Sequence length 554
Comment UTP7 SGDID:S000000884, Chr V from 325932-324268, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MGHKKNGHRRQIKERENQNKFERSTYTNNAKNNHTQTKDKKLRAGLKKIDEQYKKAVSSA
AATDYLLPESNGYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAK
NGTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQKKYTFIYDHE
GTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVSTGQLVSELRTKAGPTMAMAQ
NPWNAVMHLGHSNGTVSLWSPSMPEPLVKLLSARGPVNSIAIDRSGYYMATTGADRSMKI
WDIRNFKQLHSVESLPTPGTNVSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGG
NPHRNTPYMSHLFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFE
TKKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTMDANNKAKTN
SDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQKQLDKEKNIRKRNHQIKQGLISE
DHKDVIEEALSRFG
Download sequence
Identical sequences B3LRK0 B5VHL0 C7GRR5 C8Z794 G2WCX3 H0GF65 N1P3G1 P40055 W7Q4X3 W7RFZ9
YER082C YER082C YER082C YER082C YER082C YER082C 355302 YER082C YER082C 4932.YER082C YER082C SCRT_04560 YER082C YER082C YER082c___KOG1272 YER082C YER082C YER082C

Jump to [ Top of page · Domain architecture · Domain assignment details ]