SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER088C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER088C-A   Protein: S000028754
Sequence length 107
Comment YER088C-A SGDID:S000028754, Chr V from 336015-335692, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MTRLPPIPRMTVTLTTRPAVPTCNEGSSILHYIYIPIYEPNEQKEKRRRKTPPEPRAYTT
TTTIATNSRISGCSLTLEDGIHLRGKRAETARLPAATPQKRTGPARG
Download sequence
Identical sequences YER088C-A YER088C-A YER088C-A 4932.YER088C-A YER088C-A YER088C-A YER088C-A YER088C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]