SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER089C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER089C
Domain Number 1 Region: 3-292
Classification Level Classification E-value
Superfamily PP2C-like 4.45e-77
Family PP2C-like 0.00000601
Further Details:      
 

Protein sequence

External link(s) Locus: YER089C   Protein: S000000891
Sequence length 464
Comment PTC2 SGDID:S000000891, Chr V from 337336-335942, reverse complement, Verified ORF, "Type 2C protein phosphatase; dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; role in DNA checkpoint inactivation"
Sequence
MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGI
FDGHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRALIDTFINTDVKLLQDPVMKEDHSGC
TATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMD
RVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCL
TSQDCVDLVHLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVALLKEGEDVA
QWSDRMKSKAHRTSVRSFADKRRRVFSYYDFSKCNDEQVFAITTKKPQDKFTRDHEAAVA
SVTAADNDDPMDIDDTDADTDAENLDPSSQSKSKTSGPIDLASLEALLGATGGVKTDSNG
NKVTYTLPQSALAQLLQTMGHDPASSHPENDSNTDHKAGRSHLQ
Download sequence
Identical sequences A6ZR45 B3LRK7 C8Z7A5 E7KMQ4 N1P4Z2 P39966 W7Q4Y1
YER089C 4932.YER089C YER089C YER089C SCRT_04567 YER089C YER089C tr|A6ZR45|A6ZR45_YEAS7 YER089C YER089C YER089C YER089C YER089C YER089C

Jump to [ Top of page · Domain architecture · Domain assignment details ]