SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER089C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER089C
Domain Number 1 Region: 3-292
Classification Level Classification E-value
Superfamily PP2C-like 4.45e-77
Family PP2C-like 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
phosphoprotein phosphatase activity 2.035 108.93
phosphoric ester hydrolase activity 1.595 67.26
SMAD binding 2.192 9.71
lyase activity 1.477 8.37
enzyme activator activity 1.401 3.52
kinase activator activity 1.957 3.52
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YER089C   Protein: S000000891
Sequence length 464
Comment PTC2 SGDID:S000000891, Chr V from 337336-335942, reverse complement, Verified ORF, "Type 2C protein phosphatase; dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; role in DNA checkpoint inactivation"
Sequence
MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGI
FDGHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRALIDTFINTDVKLLQDPVMKEDHSGC
TATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMD
RVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCL
TSQDCVDLVHLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVALLKEGEDVA
QWSDRMKSKAHRTSVRSFADKRRRVFSYYDFSKCNDEQVFAITTKKPQDKFTRDHEAAVA
SVTAADNDDPMDIDDTDADTDAENLDPSSQSKSKTSGPIDLASLEALLGATGGVKTDSNG
NKVTYTLPQSALAQLLQTMGHDPASSHPENDSNTDHKAGRSHLQ
Download sequence
Identical sequences A6ZR45 B3LRK7 C8Z7A5 E7KMQ4 N1P4Z2 P39966 W7Q4Y1
YER089C YER089C YER089C YER089C 4932.YER089C SCRT_04567 YER089C YER089C tr|A6ZR45|A6ZR45_YEAS7 YER089C YER089C YER089C YER089C YER089C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]