SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER103W
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.76e-73
Family Actin/HSP70 1e-07
Further Details:      
 
Domain Number 2 Region: 188-380
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.25e-70
Family Actin/HSP70 6.37e-08
Further Details:      
 
Domain Number 3 Region: 386-541
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 5.62e-64
Family Heat shock protein 70kD (HSP70), peptide-binding domain 2.23e-07
Further Details:      
 
Domain Number 4 Region: 535-617
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 2.09e-25
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00022
Further Details:      
 

Protein sequence

External link(s) Locus: YER103W   Protein: S000000905
Sequence length 642
Comment SSA4 SGDID:S000000905, Chr V from 364585-366513, Verified ORF, "Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation"
Sequence
MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMN
PHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSM
ILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA
YGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLA
EEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARF
EELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRS
INPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPT
KKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDA
NGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQL
ESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGV
ANPIMSKFYGAAGGAPGAGPVPGAGAGPTGAPDNGPTVEEVD
Download sequence
Identical sequences P22202
YER103W YER103W 4932.YER103W YER103W YER103W YER103W

Jump to [ Top of page · Domain architecture · Domain assignment details ]