SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER103W
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.76e-73
Family Actin/HSP70 0.0000001
Further Details:      
 
Domain Number 2 Region: 188-380
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.25e-70
Family Actin/HSP70 0.0000000637
Further Details:      
 
Domain Number 3 Region: 386-541
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 5.62e-64
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000223
Further Details:      
 
Domain Number 4 Region: 535-617
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 2.09e-25
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell-substrate junction 1.489 30.57
actin-based cell projection 1.624 25.63
cell leading edge 1.401 20.51
chromosomal part 1.471 16.54
nuclear chromosome 1.727 16.54
nuclear chromatin 2.17 16.54
cell body 1.528 14.72
transporter complex 1.657 14.67
actin cytoskeleton 1.39 14.37
endoplasmic reticulum part 1.329 13.24
Molecular Function IC (bits) H-Score
unfolded protein binding 2.088 19.6
protein domain specific binding 1.437 16.74
carbohydrate binding 1.864 14.82
nuclear hormone receptor binding 1.98 12.13
ATP binding 1.507 11.84
antigen binding 2.159 11.67
isomerase activity 1.598 11.55
racemase and epimerase activity 2.232 11.55
chaperone binding 2.245 6.78
heat shock protein binding 2.127 5.73

Protein sequence

External link(s) Locus: YER103W   Protein: S000000905
Sequence length 642
Comment SSA4 SGDID:S000000905, Chr V from 364585-366513, Verified ORF, "Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation"
Sequence
MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMN
PHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSM
ILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA
YGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLA
EEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARF
EELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRS
INPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPT
KKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDA
NGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQL
ESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGV
ANPIMSKFYGAAGGAPGAGPVPGAGAGPTGAPDNGPTVEEVD
Download sequence
Identical sequences P22202
YER103W YER103W YER103W 4932.YER103W YER103W YER103W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]