SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER103W
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.76e-73
Family Actin/HSP70 0.0000001
Further Details:      
 
Domain Number 2 Region: 188-380
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.25e-70
Family Actin/HSP70 0.0000000637
Further Details:      
 
Domain Number 3 Region: 386-541
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 5.62e-64
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000223
Further Details:      
 
Domain Number 4 Region: 535-617
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 2.09e-25
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin filament 2.158 18.3
cation channel complex 2.038 15.97
SWI/SNF superfamily-type complex 2.177 14.97
endoplasmic reticulum part 1.429 14.05
nuclear chromosome 1.723 13.94
chromosomal part 1.478 13.94
chromatin 1.906 13.94
cilium 1.61 13.72
cilium part 1.917 13.72
microtubule cytoskeleton 1.333 8.5

Protein sequence

External link(s) Locus: YER103W   Protein: S000000905
Sequence length 642
Comment SSA4 SGDID:S000000905, Chr V from 364585-366513, Verified ORF, "Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation"
Sequence
MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMN
PHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSM
ILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA
YGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLA
EEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARF
EELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRS
INPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPT
KKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDA
NGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQL
ESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGV
ANPIMSKFYGAAGGAPGAGPVPGAGAGPTGAPDNGPTVEEVD
Download sequence
Identical sequences P22202
YER103W YER103W YER103W YER103W 4932.YER103W YER103W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]