SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER107C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER107C
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.72e-50
Family Cell cycle arrest protein BUB3 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
vacuole 1.428 11.94
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42
cytoplasmic vesicle part 1.738 10.37
cytoplasmic vesicle membrane 1.923 10.37
SWI/SNF superfamily-type complex 2.178 9.97

Protein sequence

External link(s) Locus: YER107C   Protein: S000000909
Sequence length 365
Comment GLE2 SGDID:S000000909, Chr V from 374541-373444, reverse complement, Verified ORF, "Component of the nuclear pore complex required for polyadenylated RNA export but not for protein import, homologous to S. pombe Rae1p"
Sequence
MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDFMFSASSWDGK
VRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMH
SAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLV
VATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDG
MQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ
RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVK
EKKKR
Download sequence
Identical sequences A6ZR63 B3LRM4 C7GS78 C8Z7C5 E7KMR8 E7LTJ0 E7NGV7 E7QE02 G2WD16 P40066 W7PVZ8 W7QZK3
YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C 4932.YER107C YER107C SCRT_04585 YER107C YER107C YER107C tr|A6ZR63|A6ZR63_YEAS7 YER107C YER107C YER107C YER107C YER107C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]