SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER107C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER107C
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.72e-50
Family Cell cycle arrest protein BUB3 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YER107C   Protein: S000000909
Sequence length 365
Comment GLE2 SGDID:S000000909, Chr V from 374541-373444, reverse complement, Verified ORF, "Component of the nuclear pore complex required for polyadenylated RNA export but not for protein import, homologous to S. pombe Rae1p"
Sequence
MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDFMFSASSWDGK
VRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMH
SAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLV
VATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDG
MQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ
RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVK
EKKKR
Download sequence
Identical sequences A0A0L8VRL5 A6ZR63 B3LRM4 C7GS78 C8Z7C5 E7KMR8 E7LTJ0 E7NGV7 E7QE02 G2WD16 P40066
YER107C YER107C YER107C YER107C SCRT_04585 YER107C YER107C tr|A6ZR63|A6ZR63_YEAS7 YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C 4932.YER107C YER107C YER107C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]